Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 1215

{
    "geneID": 1215,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AL132800.4"
        ]
    },
    "genePos": {
        "start": 24505353,
        "end": 24508265
    },
    "orientation": true,
    "symbol": "CMA1",
    "created": {
        "$date": {
            "$numberLong": "1738333348734"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000092009",
        "enseRnaID": [
            "ENST00000206446.4"
        ],
        "enseProtID": [
            "ENSP00000206446.4"
        ]
    },
    "chrom": {
        "pos": "14",
        "type": 1,
        "loc": "14q12"
    },
    "desc": "chymase 1",
    "geneType": 5,
    "mim": [
        {
            "id": 118938,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-1474244",
            "term": "Extracellular matrix organization",
            "cat": 10
        },
        {
            "id": "R-HSA-162582",
            "term": "Signal Transduction",
            "cat": 10
        },
        {
            "id": "R-HSA-392499",
            "term": "Metabolism of proteins",
            "cat": 10
        },
        {
            "id": "R-HSA-1474228",
            "term": "Degradation of the extracellular matrix",
            "cat": 11
        },
        {
            "id": "R-HSA-2980736",
            "term": "Peptide hormone metabolism",
            "cat": 11
        },
        {
            "id": "R-HSA-9006934",
            "term": "Signaling by Receptor Tyrosine Kinases",
            "cat": 11
        },
        {
            "id": "R-HSA-1433557",
            "term": "Signaling by SCF-KIT",
            "cat": 12
        },
        {
            "id": "R-HSA-1592389",
            "term": "Activation of Matrix Metalloproteinases",
            "cat": 12
        },
        {
            "id": "R-HSA-2022377",
            "term": "Metabolism of Angiotensinogen to Angiotensins",
            "cat": 12
        },
        {
            "id": "GO:0004175",
            "term": "endopeptidase activity",
            "pubMed": [
                9256427,
                12062105
            ],
            "cat": 0
        },
        {
            "id": "GO:0004252",
            "term": "serine-type endopeptidase activity",
            "cat": 0
        },
        {
            "id": "GO:0004252",
            "term": "serine-type endopeptidase activity",
            "pubMed": [
                1919436
            ],
            "cat": 0
        },
        {
            "id": "GO:0004252",
            "term": "serine-type endopeptidase activity",
            "pubMed": [
                8144971
            ],
            "cat": 0
        },
        {
            "id": "GO:0008236",
            "term": "serine-type peptidase activity",
            "pubMed": [
                2266130,
                11502696
            ],
            "cat": 0
        },
        {
            "id": "GO:0042277",
            "term": "peptide binding",
            "cat": 0
        },
        {
            "id": "GO:0002003",
            "term": "angiotensin maturation",
            "cat": 1
        },
        {
            "id": "GO:0006518",
            "term": "peptide metabolic process",
            "cat": 1
        },
        {
            "id": "GO:0022617",
            "term": "extracellular matrix disassembly",
            "pubMed": [
                27068509
            ],
            "cat": 1
        },
        {
            "id": "GO:0030163",
            "term": "protein catabolic process",
            "cat": 1
        },
        {
            "id": "GO:0030901",
            "term": "midbrain development",
            "cat": 1
        },
        {
            "id": "GO:0034769",
            "term": "basement membrane disassembly",
            "pubMed": [
                27068509
            ],
            "cat": 1
        },
        {
            "id": "GO:0045766",
            "term": "positive regulation of angiogenesis",
            "cat": 1
        },
        {
            "id": "GO:0050727",
            "term": "regulation of inflammatory response",
            "pubMed": [
                1919436
            ],
            "cat": 1
        },
        {
            "id": "GO:0051604",
            "term": "protein maturation",
            "cat": 1
        },
        {
            "id": "GO:0071333",
            "term": "cellular response to glucose stimulus",
            "cat": 1
        },
        {
            "id": "GO:0140447",
            "term": "cytokine precursor processing",
            "pubMed": [
                1919436
            ],
            "cat": 1
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "pubMed": [
                27068509
            ],
            "cat": 2
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "cat": 2
        },
        {
            "id": "GO:0005615",
            "term": "extracellular space",
            "cat": 2
        },
        {
            "id": "GO:0005829",
            "term": "cytosol",
            "cat": 2
        },
        {
            "id": "GO:0030141",
            "term": "secretory granule",
            "pubMed": [
                29529050
            ],
            "cat": 2
        },
        {
            "id": "GO:0036464",
            "term": "cytoplasmic ribonucleoprotein granule",
            "cat": 2
        },
        {
            "id": "GO:0062023",
            "term": "collagen-containing extracellular matrix",
            "pubMed": [
                20551380
            ],
            "cat": 2
        },
        {
            "id": "GO:0062023",
            "term": "collagen-containing extracellular matrix",
            "pubMed": [
                27559042
            ],
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "CMA1_HUMAN",
            "name": "Chymase",
            "accession": [
                "P23946",
                "B5BUM8",
                "Q16018",
                "Q3SY36",
                "Q3SY37",
                "Q9UDH5"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EC": [
                    "3.4.21.39",
                    "3.4.21.39"
                ],
                "EMBL": [
                    "M64269",
                    "M69137",
                    "M69136",
                    "AB451464",
                    "AL132800",
                    "CH471078",
                    "BC069110",
                    "BC069370",
                    "BC069490",
                    "BC103974",
                    "BC103975",
                    "S61334",
                    "X59072"
                ],
                "CCDS": [
                    "CCDS76666.1",
                    "CCDS9630.1"
                ],
                "PIR": [
                    "A40967"
                ],
                "RefSeq": [
                    "NP_001295012.1",
                    "NP_001827.1"
                ],
                "PDB": [
                    "1KLT",
                    "1NN6",
                    "1PJP",
                    "1T31",
                    "2HVX",
                    "3N7O",
                    "3S0N",
                    "4AFQ",
                    "4AFS",
                    "4AFU",
                    "4AFZ",
                    "4AG1",
                    "4AG2",
                    "4K2Y",
                    "4K5Z",
                    "4K60",
                    "4K69",
                    "4KP0",
                    "5YJM",
                    "5YJP"
                ],
                "PDBsum": [
                    "1KLT",
                    "1NN6",
                    "1PJP",
                    "1T31",
                    "2HVX",
                    "3N7O",
                    "3S0N",
                    "4AFQ",
                    "4AFS",
                    "4AFU",
                    "4AFZ",
                    "4AG1",
                    "4AG2",
                    "4K2Y",
                    "4K5Z",
                    "4K60",
                    "4K69",
                    "4KP0",
                    "5YJM",
                    "5YJP"
                ],
                "AlphaFoldDB": [
                    "P23946"
                ],
                "SMR": [
                    "P23946"
                ],
                "BioGRID": [
                    "107624"
                ],
                "IntAct": [
                    "P23946"
                ],
                "STRING": [
                    "9606.ENSP00000250378"
                ],
                "BindingDB": [
                    "P23946"
                ],
                "ChEMBL": [
                    "CHEMBL4068"
                ],
                "DrugBank": [
                    "DB03814",
                    "DB04016",
                    "DB07680",
                    "DB03297"
                ],
                "DrugCentral": [
                    "P23946"
                ],
                "GuidetoPHARMACOLOGY": [
                    "2340"
                ],
                "MEROPS": [
                    "S01.140"
                ],
                "GlyCosmos": [
                    "P23946"
                ],
                "GlyGen": [
                    "P23946"
                ],
                "iPTMnet": [
                    "P23946"
                ],
                "PhosphoSitePlus": [
                    "P23946"
                ],
                "BioMuta": [
                    "CMA1"
                ],
                "DMDM": [
                    "126825"
                ],
                "jPOST": [
                    "P23946"
                ],
                "MassIVE": [
                    "P23946"
                ],
                "PaxDb": [
                    "9606-ENSP00000250378"
                ],
                "PeptideAtlas": [
                    "P23946"
                ],
                "ProteomicsDB": [
                    "54171"
                ],
                "Antibodypedia": [
                    "3125"
                ],
                "DNASU": [
                    "1215"
                ],
                "Ensembl": [
                    "ENST00000206446.4",
                    "ENST00000250378.7"
                ],
                "KEGG": [
                    "hsa:1215"
                ],
                "MANE-Select": [
                    "ENST00000250378.7"
                ],
                "UCSC": [
                    "uc001wpp.2"
                ],
                "AGR": [
                    "HGNC:2097"
                ],
                "CTD": [
                    "1215"
                ],
                "DisGeNET": [
                    "1215"
                ],
                "GeneCards": [
                    "CMA1"
                ],
                "HGNC": [
                    "HGNC:2097"
                ],
                "HPA": [
                    "ENSG00000092009"
                ],
                "MIM": [
                    "118938"
                ],
                "neXtProt": [
                    "NX_P23946"
                ],
                "OpenTargets": [
                    "ENSG00000092009"
                ],
                "PharmGKB": [
                    "PA26623"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000092009"
                ],
                "eggNOG": [
                    "KOG3627"
                ],
                "GeneTree": [
                    "ENSGT01030000234551"
                ],
                "HOGENOM": [
                    "CLU_006842_1_0_1"
                ],
                "InParanoid": [
                    "P23946"
                ],
                "OMA": [
                    "MDPQACR"
                ],
                "OrthoDB": [
                    "2540265at2759"
                ],
                "PhylomeDB": [
                    "P23946"
                ],
                "TreeFam": [
                    "TF333630"
                ],
                "BRENDA": [
                    "3.4.21.39"
                ],
                "PathwayCommons": [
                    "P23946"
                ],
                "Reactome": [
                    "R-HSA-1433557",
                    "R-HSA-1592389",
                    "R-HSA-2022377"
                ],
                "SABIO-RK": [
                    "P23946"
                ],
                "SignaLink": [
                    "P23946"
                ],
                "SIGNOR": [
                    "P23946"
                ],
                "BioGRID-ORCS": [
                    "1215"
                ],
                "EvolutionaryTrace": [
                    "P23946"
                ],
                "GeneWiki": [
                    "CMA1"
                ],
                "GenomeRNAi": [
                    "1215"
                ],
                "Pharos": [
                    "P23946"
                ],
                "PRO": [
                    "PR:P23946"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P23946"
                ],
                "Bgee": [
                    "ENSG00000092009"
                ],
                "GO": [
                    "GO:0062023",
                    "GO:0005737",
                    "GO:0036464",
                    "GO:0005829",
                    "GO:0005576",
                    "GO:0005615",
                    "GO:0043231",
                    "GO:0030141",
                    "GO:0004175",
                    "GO:0042277",
                    "GO:0004252",
                    "GO:0008236",
                    "GO:0002003",
                    "GO:0034769",
                    "GO:0071333",
                    "GO:0140447",
                    "GO:0022617",
                    "GO:0030901",
                    "GO:0006518",
                    "GO:0045766",
                    "GO:0030163",
                    "GO:0050727"
                ],
                "CDD": [
                    "cd00190"
                ],
                "Gene3D": [
                    "2.40.10.10"
                ],
                "InterPro": [
                    "IPR009003",
                    "IPR043504",
                    "IPR001314",
                    "IPR001254",
                    "IPR018114",
                    "IPR033116"
                ],
                "PANTHER": [
                    "PTHR24271:SF24",
                    "PTHR24271"
                ],
                "Pfam": [
                    "PF00089"
                ],
                "PRINTS": [
                    "PR00722"
                ],
                "SMART": [
                    "SM00020"
                ],
                "SUPFAM": [
                    "SSF50494"
                ],
                "PROSITE": [
                    "PS50240",
                    "PS00134",
                    "PS00135"
                ]
            },
            "citations": [
                {
                    "title": "Structure, chromosomal assignment, and deduced amino acid sequence of a human gene for mast cell chymase.",
                    "pubmedID": "2071582",
                    "doi": "10.1016/s0021-9258(18)98788-0"
                },
                {
                    "title": "Cloning of the gene and cDNA for human heart chymase.",
                    "pubmedID": "1894611",
                    "doi": "10.1016/s0021-9258(19)47355-9"
                },
                {
                    "title": "Determination of the primary structures of human skin chymase and cathepsin G from cutaneous mast cells of urticaria pigmentosa lesions.",
                    "pubmedID": "8144971"
                },
                {
                    "title": "Human protein factory for converting the transcriptome into an in vitro-expressed proteome.",
                    "pubmedID": "19054851",
                    "doi": "10.1038/nmeth.1273"
                },
                {
                    "title": "The DNA sequence and analysis of human chromosome 14.",
                    "pubmedID": "12508121",
                    "doi": "10.1038/nature01348"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Purification and molecular cloning of chymase from human tonsils.",
                    "pubmedID": "8495723",
                    "doi": "10.1016/0014-5793(93)81461-8"
                },
                {
                    "title": "Angiotensin II-forming heart chymase is a mast-cell-specific enzyme.",
                    "pubmedID": "2049082",
                    "doi": "10.1042/bj2760567"
                },
                {
                    "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.",
                    "pubmedID": "19159218",
                    "doi": "10.1021/pr8008012"
                },
                {
                    "title": "Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A.",
                    "pubmedID": "9400368",
                    "doi": "10.1021/bi971403n"
                },
                {
                    "title": "The 2.2-A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.",
                    "pubmedID": "9931257",
                    "doi": "10.1006/jmbi.1998.2462"
                },
                {
                    "pubmedID": "10208809",
                    "doi": "10.1006/jmbi.1999.2691"
                }
            ],
            "sequence": {
                "length": 247,
                "mass": 27325,
                "checksum": "DC1464A049ED6B00",
                "modified": {
                    "$date": {
                        "$numberLong": "699408000000"
                    }
                },
                "version": 1,
                "sequence": "MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 3819100519
        },
        {
            "symbol": "Q4FEB3_HUMAN",
            "accession": [
                "Q4FEB3"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "DQ082729",
                    "AAZ06434.1"
                ],
                "RefSeq": [
                    "NP_001295012.1",
                    "NP_001827.1"
                ],
                "AlphaFoldDB": [
                    "Q4FEB3"
                ],
                "MEROPS": [
                    "S01.140"
                ],
                "PeptideAtlas": [
                    "Q4FEB3"
                ],
                "DNASU": [
                    "1215"
                ],
                "KEGG": [
                    "hsa:1215"
                ],
                "CTD": [
                    "1215"
                ],
                "DisGeNET": [
                    "1215"
                ],
                "OrthoDB": [
                    "2540265at2759"
                ],
                "BioGRID-ORCS": [
                    "1215"
                ],
                "GO": [
                    "GO:0005737",
                    "GO:0005615",
                    "GO:0043231",
                    "GO:0004252",
                    "GO:0006508"
                ],
                "CDD": [
                    "cd00190"
                ],
                "Gene3D": [
                    "2.40.10.10"
                ],
                "InterPro": [
                    "IPR009003",
                    "IPR043504",
                    "IPR001314",
                    "IPR001254",
                    "IPR018114"
                ],
                "PANTHER": [
                    "PTHR24271:SF24",
                    "PTHR24271"
                ],
                "Pfam": [
                    "PF00089"
                ],
                "PRINTS": [
                    "PR00722"
                ],
                "SMART": [
                    "SM00020"
                ],
                "SUPFAM": [
                    "SSF50494"
                ],
                "PROSITE": [
                    "PS50240",
                    "PS00134",
                    "PS50240"
                ],
                "ARBA": [
                    "ARBA00023157"
                ]
            },
            "citations": [
                {
                    "title": "Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.",
                    "pubmedID": "16400609",
                    "doi": "10.1086/500151"
                }
            ],
            "sequence": {
                "length": 148,
                "mass": 16416,
                "checksum": "607FDDB27803BB43",
                "modified": {
                    "$date": {
                        "$numberLong": "1125360000000"
                    }
                },
                "version": 1,
                "sequence": "LLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGSRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGV"
            },
            "existence": 1,
            "relevance": 2,
            "proteinID": 2024982562
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}