Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 1215
{
"geneID": 1215,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AL132800.4"
]
},
"genePos": {
"start": 24505353,
"end": 24508265
},
"orientation": true,
"symbol": "CMA1",
"created": {
"$date": {
"$numberLong": "1738333348734"
}
},
"crossReference": {
"enseGeneID": "ENSG00000092009",
"enseRnaID": [
"ENST00000206446.4"
],
"enseProtID": [
"ENSP00000206446.4"
]
},
"chrom": {
"pos": "14",
"type": 1,
"loc": "14q12"
},
"desc": "chymase 1",
"geneType": 5,
"mim": [
{
"id": 118938,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-1474244",
"term": "Extracellular matrix organization",
"cat": 10
},
{
"id": "R-HSA-162582",
"term": "Signal Transduction",
"cat": 10
},
{
"id": "R-HSA-392499",
"term": "Metabolism of proteins",
"cat": 10
},
{
"id": "R-HSA-1474228",
"term": "Degradation of the extracellular matrix",
"cat": 11
},
{
"id": "R-HSA-2980736",
"term": "Peptide hormone metabolism",
"cat": 11
},
{
"id": "R-HSA-9006934",
"term": "Signaling by Receptor Tyrosine Kinases",
"cat": 11
},
{
"id": "R-HSA-1433557",
"term": "Signaling by SCF-KIT",
"cat": 12
},
{
"id": "R-HSA-1592389",
"term": "Activation of Matrix Metalloproteinases",
"cat": 12
},
{
"id": "R-HSA-2022377",
"term": "Metabolism of Angiotensinogen to Angiotensins",
"cat": 12
},
{
"id": "GO:0004175",
"term": "endopeptidase activity",
"pubMed": [
9256427,
12062105
],
"cat": 0
},
{
"id": "GO:0004252",
"term": "serine-type endopeptidase activity",
"cat": 0
},
{
"id": "GO:0004252",
"term": "serine-type endopeptidase activity",
"pubMed": [
1919436
],
"cat": 0
},
{
"id": "GO:0004252",
"term": "serine-type endopeptidase activity",
"pubMed": [
8144971
],
"cat": 0
},
{
"id": "GO:0008236",
"term": "serine-type peptidase activity",
"pubMed": [
2266130,
11502696
],
"cat": 0
},
{
"id": "GO:0042277",
"term": "peptide binding",
"cat": 0
},
{
"id": "GO:0002003",
"term": "angiotensin maturation",
"cat": 1
},
{
"id": "GO:0006518",
"term": "peptide metabolic process",
"cat": 1
},
{
"id": "GO:0022617",
"term": "extracellular matrix disassembly",
"pubMed": [
27068509
],
"cat": 1
},
{
"id": "GO:0030163",
"term": "protein catabolic process",
"cat": 1
},
{
"id": "GO:0030901",
"term": "midbrain development",
"cat": 1
},
{
"id": "GO:0034769",
"term": "basement membrane disassembly",
"pubMed": [
27068509
],
"cat": 1
},
{
"id": "GO:0045766",
"term": "positive regulation of angiogenesis",
"cat": 1
},
{
"id": "GO:0050727",
"term": "regulation of inflammatory response",
"pubMed": [
1919436
],
"cat": 1
},
{
"id": "GO:0051604",
"term": "protein maturation",
"cat": 1
},
{
"id": "GO:0071333",
"term": "cellular response to glucose stimulus",
"cat": 1
},
{
"id": "GO:0140447",
"term": "cytokine precursor processing",
"pubMed": [
1919436
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"pubMed": [
27068509
],
"cat": 2
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"cat": 2
},
{
"id": "GO:0005829",
"term": "cytosol",
"cat": 2
},
{
"id": "GO:0030141",
"term": "secretory granule",
"pubMed": [
29529050
],
"cat": 2
},
{
"id": "GO:0036464",
"term": "cytoplasmic ribonucleoprotein granule",
"cat": 2
},
{
"id": "GO:0062023",
"term": "collagen-containing extracellular matrix",
"pubMed": [
20551380
],
"cat": 2
},
{
"id": "GO:0062023",
"term": "collagen-containing extracellular matrix",
"pubMed": [
27559042
],
"cat": 2
}
],
"protein": [
{
"symbol": "CMA1_HUMAN",
"name": "Chymase",
"accession": [
"P23946",
"B5BUM8",
"Q16018",
"Q3SY36",
"Q3SY37",
"Q9UDH5"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EC": [
"3.4.21.39",
"3.4.21.39"
],
"EMBL": [
"M64269",
"M69137",
"M69136",
"AB451464",
"AL132800",
"CH471078",
"BC069110",
"BC069370",
"BC069490",
"BC103974",
"BC103975",
"S61334",
"X59072"
],
"CCDS": [
"CCDS76666.1",
"CCDS9630.1"
],
"PIR": [
"A40967"
],
"RefSeq": [
"NP_001295012.1",
"NP_001827.1"
],
"PDB": [
"1KLT",
"1NN6",
"1PJP",
"1T31",
"2HVX",
"3N7O",
"3S0N",
"4AFQ",
"4AFS",
"4AFU",
"4AFZ",
"4AG1",
"4AG2",
"4K2Y",
"4K5Z",
"4K60",
"4K69",
"4KP0",
"5YJM",
"5YJP"
],
"PDBsum": [
"1KLT",
"1NN6",
"1PJP",
"1T31",
"2HVX",
"3N7O",
"3S0N",
"4AFQ",
"4AFS",
"4AFU",
"4AFZ",
"4AG1",
"4AG2",
"4K2Y",
"4K5Z",
"4K60",
"4K69",
"4KP0",
"5YJM",
"5YJP"
],
"AlphaFoldDB": [
"P23946"
],
"SMR": [
"P23946"
],
"BioGRID": [
"107624"
],
"IntAct": [
"P23946"
],
"STRING": [
"9606.ENSP00000250378"
],
"BindingDB": [
"P23946"
],
"ChEMBL": [
"CHEMBL4068"
],
"DrugBank": [
"DB03814",
"DB04016",
"DB07680",
"DB03297"
],
"DrugCentral": [
"P23946"
],
"GuidetoPHARMACOLOGY": [
"2340"
],
"MEROPS": [
"S01.140"
],
"GlyCosmos": [
"P23946"
],
"GlyGen": [
"P23946"
],
"iPTMnet": [
"P23946"
],
"PhosphoSitePlus": [
"P23946"
],
"BioMuta": [
"CMA1"
],
"DMDM": [
"126825"
],
"jPOST": [
"P23946"
],
"MassIVE": [
"P23946"
],
"PaxDb": [
"9606-ENSP00000250378"
],
"PeptideAtlas": [
"P23946"
],
"ProteomicsDB": [
"54171"
],
"Antibodypedia": [
"3125"
],
"DNASU": [
"1215"
],
"Ensembl": [
"ENST00000206446.4",
"ENST00000250378.7"
],
"KEGG": [
"hsa:1215"
],
"MANE-Select": [
"ENST00000250378.7"
],
"UCSC": [
"uc001wpp.2"
],
"AGR": [
"HGNC:2097"
],
"CTD": [
"1215"
],
"DisGeNET": [
"1215"
],
"GeneCards": [
"CMA1"
],
"HGNC": [
"HGNC:2097"
],
"HPA": [
"ENSG00000092009"
],
"MIM": [
"118938"
],
"neXtProt": [
"NX_P23946"
],
"OpenTargets": [
"ENSG00000092009"
],
"PharmGKB": [
"PA26623"
],
"VEuPathDB": [
"HostDB:ENSG00000092009"
],
"eggNOG": [
"KOG3627"
],
"GeneTree": [
"ENSGT01030000234551"
],
"HOGENOM": [
"CLU_006842_1_0_1"
],
"InParanoid": [
"P23946"
],
"OMA": [
"MDPQACR"
],
"OrthoDB": [
"2540265at2759"
],
"PhylomeDB": [
"P23946"
],
"TreeFam": [
"TF333630"
],
"BRENDA": [
"3.4.21.39"
],
"PathwayCommons": [
"P23946"
],
"Reactome": [
"R-HSA-1433557",
"R-HSA-1592389",
"R-HSA-2022377"
],
"SABIO-RK": [
"P23946"
],
"SignaLink": [
"P23946"
],
"SIGNOR": [
"P23946"
],
"BioGRID-ORCS": [
"1215"
],
"EvolutionaryTrace": [
"P23946"
],
"GeneWiki": [
"CMA1"
],
"GenomeRNAi": [
"1215"
],
"Pharos": [
"P23946"
],
"PRO": [
"PR:P23946"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P23946"
],
"Bgee": [
"ENSG00000092009"
],
"GO": [
"GO:0062023",
"GO:0005737",
"GO:0036464",
"GO:0005829",
"GO:0005576",
"GO:0005615",
"GO:0043231",
"GO:0030141",
"GO:0004175",
"GO:0042277",
"GO:0004252",
"GO:0008236",
"GO:0002003",
"GO:0034769",
"GO:0071333",
"GO:0140447",
"GO:0022617",
"GO:0030901",
"GO:0006518",
"GO:0045766",
"GO:0030163",
"GO:0050727"
],
"CDD": [
"cd00190"
],
"Gene3D": [
"2.40.10.10"
],
"InterPro": [
"IPR009003",
"IPR043504",
"IPR001314",
"IPR001254",
"IPR018114",
"IPR033116"
],
"PANTHER": [
"PTHR24271:SF24",
"PTHR24271"
],
"Pfam": [
"PF00089"
],
"PRINTS": [
"PR00722"
],
"SMART": [
"SM00020"
],
"SUPFAM": [
"SSF50494"
],
"PROSITE": [
"PS50240",
"PS00134",
"PS00135"
]
},
"citations": [
{
"title": "Structure, chromosomal assignment, and deduced amino acid sequence of a human gene for mast cell chymase.",
"pubmedID": "2071582",
"doi": "10.1016/s0021-9258(18)98788-0"
},
{
"title": "Cloning of the gene and cDNA for human heart chymase.",
"pubmedID": "1894611",
"doi": "10.1016/s0021-9258(19)47355-9"
},
{
"title": "Determination of the primary structures of human skin chymase and cathepsin G from cutaneous mast cells of urticaria pigmentosa lesions.",
"pubmedID": "8144971"
},
{
"title": "Human protein factory for converting the transcriptome into an in vitro-expressed proteome.",
"pubmedID": "19054851",
"doi": "10.1038/nmeth.1273"
},
{
"title": "The DNA sequence and analysis of human chromosome 14.",
"pubmedID": "12508121",
"doi": "10.1038/nature01348"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Purification and molecular cloning of chymase from human tonsils.",
"pubmedID": "8495723",
"doi": "10.1016/0014-5793(93)81461-8"
},
{
"title": "Angiotensin II-forming heart chymase is a mast-cell-specific enzyme.",
"pubmedID": "2049082",
"doi": "10.1042/bj2760567"
},
{
"title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.",
"pubmedID": "19159218",
"doi": "10.1021/pr8008012"
},
{
"title": "Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A.",
"pubmedID": "9400368",
"doi": "10.1021/bi971403n"
},
{
"title": "The 2.2-A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.",
"pubmedID": "9931257",
"doi": "10.1006/jmbi.1998.2462"
},
{
"pubmedID": "10208809",
"doi": "10.1006/jmbi.1999.2691"
}
],
"sequence": {
"length": 247,
"mass": 27325,
"checksum": "DC1464A049ED6B00",
"modified": {
"$date": {
"$numberLong": "699408000000"
}
},
"version": 1,
"sequence": "MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN"
},
"existence": 0,
"relevance": 1,
"proteinID": 3819100519
},
{
"symbol": "Q4FEB3_HUMAN",
"accession": [
"Q4FEB3"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"DQ082729",
"AAZ06434.1"
],
"RefSeq": [
"NP_001295012.1",
"NP_001827.1"
],
"AlphaFoldDB": [
"Q4FEB3"
],
"MEROPS": [
"S01.140"
],
"PeptideAtlas": [
"Q4FEB3"
],
"DNASU": [
"1215"
],
"KEGG": [
"hsa:1215"
],
"CTD": [
"1215"
],
"DisGeNET": [
"1215"
],
"OrthoDB": [
"2540265at2759"
],
"BioGRID-ORCS": [
"1215"
],
"GO": [
"GO:0005737",
"GO:0005615",
"GO:0043231",
"GO:0004252",
"GO:0006508"
],
"CDD": [
"cd00190"
],
"Gene3D": [
"2.40.10.10"
],
"InterPro": [
"IPR009003",
"IPR043504",
"IPR001314",
"IPR001254",
"IPR018114"
],
"PANTHER": [
"PTHR24271:SF24",
"PTHR24271"
],
"Pfam": [
"PF00089"
],
"PRINTS": [
"PR00722"
],
"SMART": [
"SM00020"
],
"SUPFAM": [
"SSF50494"
],
"PROSITE": [
"PS50240",
"PS00134",
"PS50240"
],
"ARBA": [
"ARBA00023157"
]
},
"citations": [
{
"title": "Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.",
"pubmedID": "16400609",
"doi": "10.1086/500151"
}
],
"sequence": {
"length": 148,
"mass": 16416,
"checksum": "607FDDB27803BB43",
"modified": {
"$date": {
"$numberLong": "1125360000000"
}
},
"version": 1,
"sequence": "LLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGSRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGV"
},
"existence": 1,
"relevance": 2,
"proteinID": 2024982562
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}