Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 1270
{
"geneID": 1270,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AP001350.4"
]
},
"genePos": {
"start": 4993,
"end": 8061
},
"orientation": true,
"symbol": "CNTF",
"created": {
"$date": {
"$numberLong": "1738333348735"
}
},
"crossReference": {
"enseGeneID": "ENSG00000242689",
"enseRnaID": [
"ENST00000361987.6"
],
"enseProtID": [
"ENSP00000355370.4"
]
},
"chrom": {
"pos": "11",
"type": 1,
"loc": "11q12.1"
},
"desc": "ciliary neurotrophic factor",
"geneType": 5,
"mim": [
{
"id": 118945,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-168256",
"term": "Immune System",
"cat": 10
},
{
"id": "R-HSA-1280215",
"term": "Cytokine Signaling in Immune system",
"cat": 11
},
{
"id": "R-HSA-449147",
"term": "Signaling by Interleukins",
"cat": 12
},
{
"id": "R-HSA-6783589",
"term": "Interleukin-6 family signaling",
"cat": 13
},
{
"id": "R-HSA-6788467",
"term": "IL-6-type cytokine receptor ligand interactions",
"cat": 14
},
{
"id": "GO:0005125",
"term": "cytokine activity",
"cat": 0
},
{
"id": "GO:0005127",
"term": "ciliary neurotrophic factor receptor binding",
"cat": 0
},
{
"id": "GO:0005138",
"term": "interleukin-6 receptor binding",
"pubMed": [
12643274
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
16051226,
18775332,
20584990,
25416956,
32296183,
32814053
],
"cat": 0
},
{
"id": "GO:0008083",
"term": "growth factor activity",
"cat": 0
},
{
"id": "GO:0008083",
"term": "growth factor activity",
"pubMed": [
12643274
],
"cat": 0
},
{
"id": "GO:0044877",
"term": "protein-containing complex binding",
"pubMed": [
10966616
],
"cat": 0
},
{
"id": "GO:0007165",
"term": "signal transduction",
"pubMed": [
1840538
],
"cat": 1
},
{
"id": "GO:0007259",
"term": "cell surface receptor signaling pathway via JAK-STAT",
"cat": 1
},
{
"id": "GO:0008284",
"term": "positive regulation of cell population proliferation",
"cat": 1
},
{
"id": "GO:0010628",
"term": "positive regulation of gene expression",
"pubMed": [
24129709
],
"cat": 1
},
{
"id": "GO:0042531",
"term": "positive regulation of tyrosine phosphorylation of STAT protein",
"pubMed": [
21912637
],
"cat": 1
},
{
"id": "GO:0043524",
"term": "negative regulation of neuron apoptotic process",
"cat": 1
},
{
"id": "GO:0043524",
"term": "negative regulation of neuron apoptotic process",
"pubMed": [
10966616
],
"cat": 1
},
{
"id": "GO:0046533",
"term": "negative regulation of photoreceptor cell differentiation",
"cat": 1
},
{
"id": "GO:0046668",
"term": "regulation of retinal cell programmed cell death",
"cat": 1
},
{
"id": "GO:0048143",
"term": "astrocyte activation",
"cat": 1
},
{
"id": "GO:0048644",
"term": "muscle organ morphogenesis",
"cat": 1
},
{
"id": "GO:0048666",
"term": "neuron development",
"cat": 1
},
{
"id": "GO:0048680",
"term": "positive regulation of axon regeneration",
"cat": 1
},
{
"id": "GO:0060221",
"term": "retinal rod cell differentiation",
"cat": 1
},
{
"id": "GO:0070120",
"term": "ciliary neurotrophic factor-mediated signaling pathway",
"cat": 1
},
{
"id": "GO:0070120",
"term": "ciliary neurotrophic factor-mediated signaling pathway",
"pubMed": [
12643274
],
"cat": 1
},
{
"id": "GO:0097696",
"term": "cell surface receptor signaling pathway via STAT",
"pubMed": [
12643274
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"pubMed": [
12643274
],
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
},
{
"id": "GO:0030424",
"term": "axon",
"cat": 2
},
{
"id": "GO:0043025",
"term": "neuronal cell body",
"cat": 2
},
{
"id": "GO:0097386",
"term": "glial cell projection",
"cat": 2
}
],
"geneRelations": [
{
"type": 3,
"similarGenes": [
"386607"
]
}
],
"protein": [
{
"symbol": "CNTF_HUMAN",
"name": "Ciliary neurotrophic factor",
"accession": [
"P26441",
"B2RAB2"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"X60542",
"X60477",
"X60478",
"X55889",
"X55890",
"AK314118",
"CH471076",
"BC068030",
"BC074963",
"BC074964"
],
"CCDS": [
"CCDS31554.1"
],
"PIR": [
"JH0455"
],
"RefSeq": [
"NP_000605.1"
],
"PDB": [
"1CNT",
"8D74"
],
"PDBsum": [
"1CNT",
"8D74"
],
"AlphaFoldDB": [
"P26441"
],
"EMDB": [
"EMD-27227"
],
"SMR": [
"P26441"
],
"BioGRID": [
"107670"
],
"CORUM": [
"P26441"
],
"DIP": [
"DIP-5776N"
],
"IntAct": [
"P26441"
],
"MINT": [
"P26441"
],
"STRING": [
"9606.ENSP00000355370"
],
"PhosphoSitePlus": [
"P26441"
],
"BioMuta": [
"CNTF"
],
"MassIVE": [
"P26441"
],
"PaxDb": [
"9606-ENSP00000355370"
],
"PeptideAtlas": [
"P26441"
],
"ProteomicsDB": [
"54349"
],
"Antibodypedia": [
"34925"
],
"DNASU": [
"1270"
],
"Ensembl": [
"ENST00000361987.6"
],
"KEGG": [
"hsa:1270"
],
"MANE-Select": [
"ENST00000361987.6"
],
"UCSC": [
"uc001nna.5"
],
"AGR": [
"HGNC:2169"
],
"CTD": [
"1270"
],
"DisGeNET": [
"1270"
],
"GeneCards": [
"CNTF"
],
"HGNC": [
"HGNC:2169"
],
"HPA": [
"ENSG00000242689"
],
"MIM": [
"118945"
],
"neXtProt": [
"NX_P26441"
],
"OpenTargets": [
"ENSG00000242689"
],
"PharmGKB": [
"PA26683"
],
"VEuPathDB": [
"HostDB:ENSG00000242689"
],
"eggNOG": [
"ENOG502S4XX"
],
"GeneTree": [
"ENSGT00420000029890"
],
"HOGENOM": [
"CLU_118647_0_0_1"
],
"InParanoid": [
"P26441"
],
"OMA": [
"RWSEMTE"
],
"OrthoDB": [
"4215903at2759"
],
"PhylomeDB": [
"P26441"
],
"TreeFam": [
"TF336237"
],
"PathwayCommons": [
"P26441"
],
"Reactome": [
"R-HSA-6788467"
],
"SignaLink": [
"P26441"
],
"SIGNOR": [
"P26441"
],
"BioGRID-ORCS": [
"1270"
],
"EvolutionaryTrace": [
"P26441"
],
"GeneWiki": [
"Ciliary_neurotrophic_factor"
],
"GenomeRNAi": [
"1270"
],
"Pharos": [
"P26441"
],
"PRO": [
"PR:P26441"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P26441"
],
"Bgee": [
"ENSG00000242689"
],
"GO": [
"GO:0030424",
"GO:0005737",
"GO:0005576",
"GO:0005615",
"GO:0005127",
"GO:0005125",
"GO:0008083",
"GO:0005138",
"GO:0044877",
"GO:0048143",
"GO:0070120",
"GO:0048644",
"GO:0043524",
"GO:0046533",
"GO:0048666",
"GO:0048680",
"GO:0008284",
"GO:0010628",
"GO:0042531",
"GO:0046668",
"GO:0060221",
"GO:0007165"
],
"Gene3D": [
"1.20.1250.10"
],
"InterPro": [
"IPR009079",
"IPR000151"
],
"PANTHER": [
"PTHR15196",
"PTHR15196:SF0"
],
"Pfam": [
"PF01110"
],
"SUPFAM": [
"SSF47266"
]
},
"citations": [
{
"title": "Recombinant human and rat ciliary neurotrophic factors.",
"pubmedID": "1861138",
"doi": "10.1111/j.1471-4159.1991.tb08250.x"
},
{
"title": "Cloning and expression of human ciliary neurotrophic factor.",
"pubmedID": "1915374",
"doi": "10.1111/j.1432-1033.1991.tb16286.x"
},
{
"title": "Sequence and structural organization of the human gene encoding ciliary neurotrophic factor.",
"pubmedID": "1840538",
"doi": "10.1016/0378-1119(91)90089-t"
},
{
"title": "Expression and characterization of recombinant human ciliary neurotrophic factor from Escherichia coli.",
"pubmedID": "1883844",
"doi": "10.1016/0167-4781(91)90038-n"
},
{
"title": "A null mutation in the human CNTF gene is not causally related to neurological diseases.",
"pubmedID": "8075647",
"doi": "10.1038/ng0594-79"
},
{
"title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
"pubmedID": "14702039",
"doi": "10.1038/ng1285"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Crystal structure of dimeric human ciliary neurotrophic factor determined by MAD phasing.",
"pubmedID": "7796798",
"doi": "10.1002/j.1460-2075.1995.tb07269.x"
},
{
"title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.",
"pubmedID": "10391209",
"doi": "10.1038/10290"
}
],
"sequence": {
"length": 200,
"mass": 22931,
"checksum": "EDD9D895BDA6F35A",
"modified": {
"$date": {
"$numberLong": "712627200000"
}
},
"version": 1,
"sequence": "MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM"
},
"existence": 0,
"relevance": 1,
"proteinID": 2214813036
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}