Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 1617

{
    "geneID": 1617,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC010088.4"
        ]
    },
    "genePos": {
        "start": 5085,
        "end": 74738
    },
    "orientation": false,
    "symbol": "DAZ1",
    "created": {
        "$date": {
            "$numberLong": "1738333348762"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000188120",
        "enseRnaID": [
            "ENST00000540248.5"
        ],
        "enseProtID": [
            "ENSP00000444407.1"
        ]
    },
    "chrom": {
        "loc": "Yq11.223"
    },
    "desc": "deleted in azoospermia 1",
    "geneType": 5,
    "mim": [
        {
            "id": 400003,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "GO:0003730",
            "term": "mRNA 3'-UTR binding",
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                10857750,
                12511597,
                15081113,
                16001084
            ],
            "cat": 0
        },
        {
            "id": "GO:0008494",
            "term": "translation activator activity",
            "cat": 0
        },
        {
            "id": "GO:0008494",
            "term": "translation activator activity",
            "pubMed": [
                16001084
            ],
            "cat": 0
        },
        {
            "id": "GO:0007283",
            "term": "spermatogenesis",
            "cat": 1
        },
        {
            "id": "GO:0030154",
            "term": "cell differentiation",
            "cat": 1
        },
        {
            "id": "GO:0045948",
            "term": "positive regulation of translational initiation",
            "cat": 1
        },
        {
            "id": "GO:0045948",
            "term": "positive regulation of translational initiation",
            "pubMed": [
                16001084
            ],
            "cat": 1
        },
        {
            "id": "GO:0070935",
            "term": "3'-UTR-mediated mRNA stabilization",
            "cat": 1
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "pubMed": [
                15081113
            ],
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "pubMed": [
                15081113
            ],
            "cat": 2
        },
        {
            "id": "GO:0032991",
            "term": "protein-containing complex",
            "pubMed": [
                10857750
            ],
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "DAZ1_HUMAN",
            "name": "Deleted in azoospermia protein 1",
            "accession": [
                "Q9NQZ3",
                "Q1RMF9",
                "Q9NQZ4"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "MIM": [
                    "415000",
                    "400003",
                    "415000"
                ],
                "EMBL": [
                    "AC010088",
                    "AC053490",
                    "AC006338",
                    "BC114927",
                    "AF271087",
                    "AF271088"
                ],
                "CCDS": [
                    "CCDS48209.1"
                ],
                "RefSeq": [
                    "NP_004072.3"
                ],
                "AlphaFoldDB": [
                    "Q9NQZ3"
                ],
                "BioGRID": [
                    "107986"
                ],
                "IntAct": [
                    "Q9NQZ3"
                ],
                "STRING": [
                    "9606.ENSP00000384573"
                ],
                "iPTMnet": [
                    "Q9NQZ3"
                ],
                "PhosphoSitePlus": [
                    "Q9NQZ3"
                ],
                "BioMuta": [
                    "DAZ1"
                ],
                "DMDM": [
                    "44887841"
                ],
                "MassIVE": [
                    "Q9NQZ3"
                ],
                "PeptideAtlas": [
                    "Q9NQZ3"
                ],
                "ProteomicsDB": [
                    "61241"
                ],
                "Antibodypedia": [
                    "21891"
                ],
                "DNASU": [
                    "1617"
                ],
                "Ensembl": [
                    "ENST00000405239.6"
                ],
                "KEGG": [
                    "hsa:1617"
                ],
                "MANE-Select": [
                    "ENST00000405239.6"
                ],
                "UCSC": [
                    "uc004fvl.4"
                ],
                "AGR": [
                    "HGNC:2682"
                ],
                "CTD": [
                    "1617"
                ],
                "DisGeNET": [
                    "1617"
                ],
                "GeneCards": [
                    "DAZ1"
                ],
                "GeneReviews": [
                    "DAZ1"
                ],
                "HGNC": [
                    "HGNC:2682"
                ],
                "HPA": [
                    "ENSG00000188120"
                ],
                "MalaCards": [
                    "DAZ1"
                ],
                "neXtProt": [
                    "NX_Q9NQZ3"
                ],
                "OpenTargets": [
                    "ENSG00000188120"
                ],
                "Orphanet": [
                    "1646"
                ],
                "PharmGKB": [
                    "PA27149"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000188120"
                ],
                "GeneTree": [
                    "ENSGT00530000063480"
                ],
                "HOGENOM": [
                    "CLU_022076_0_0_1"
                ],
                "InParanoid": [
                    "Q9NQZ3"
                ],
                "OrthoDB": [
                    "4705505at2759"
                ],
                "PhylomeDB": [
                    "Q9NQZ3"
                ],
                "TreeFam": [
                    "TF324396"
                ],
                "PathwayCommons": [
                    "Q9NQZ3"
                ],
                "SignaLink": [
                    "Q9NQZ3"
                ],
                "BioGRID-ORCS": [
                    "1617"
                ],
                "ChiTaRS": [
                    "DAZ1"
                ],
                "GeneWiki": [
                    "DAZ1"
                ],
                "GenomeRNAi": [
                    "1617"
                ],
                "Pharos": [
                    "Q9NQZ3"
                ],
                "PRO": [
                    "PR:Q9NQZ3"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "Q9NQZ3"
                ],
                "Bgee": [
                    "ENSG00000188120"
                ],
                "ExpressionAtlas": [
                    "Q9NQZ3"
                ],
                "GO": [
                    "GO:0005737",
                    "GO:0005634",
                    "GO:0032991",
                    "GO:0003730",
                    "GO:0008494",
                    "GO:0070935",
                    "GO:0030154",
                    "GO:0045948",
                    "GO:0007283"
                ],
                "CDD": [
                    "cd12672"
                ],
                "Gene3D": [
                    "3.30.70.330"
                ],
                "InterPro": [
                    "IPR043628",
                    "IPR037551",
                    "IPR012677",
                    "IPR035979",
                    "IPR000504"
                ],
                "PANTHER": [
                    "PTHR11176",
                    "PTHR11176:SF8"
                ],
                "Pfam": [
                    "PF18872",
                    "PF00076"
                ],
                "SMART": [
                    "SM00360"
                ],
                "SUPFAM": [
                    "SSF54928"
                ],
                "PROSITE": [
                    "PS51890",
                    "PS50102"
                ]
            },
            "citations": [
                {
                    "title": "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.",
                    "pubmedID": "12815422",
                    "doi": "10.1038/nature01722"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Four DAZ genes in two clusters found in the AZFc region of the human Y chromosome.",
                    "pubmedID": "10936047",
                    "doi": "10.1006/geno.2000.6260"
                },
                {
                    "title": "Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.",
                    "pubmedID": "10857750",
                    "doi": "10.1006/geno.2000.6169"
                },
                {
                    "title": "DAZ family proteins exist throughout male germ cell development and transit from nucleus to cytoplasm at meiosis in humans and mice.",
                    "pubmedID": "11058556",
                    "doi": "10.1095/biolreprod63.5.1490"
                },
                {
                    "title": "In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein.",
                    "pubmedID": "10903443",
                    "doi": "10.1016/s0378-1119(00)00219-5"
                },
                {
                    "title": "A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans.",
                    "pubmedID": "11390979",
                    "doi": "10.1073/pnas.131090498"
                },
                {
                    "title": "Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.",
                    "pubmedID": "12511597",
                    "doi": "10.1073/pnas.0234478100"
                },
                {
                    "title": "Polymorphic DAZ gene family in polymorphic structure of AZFc locus: artwork or functional for human spermatogenesis?",
                    "pubmedID": "12752250",
                    "doi": "10.1034/j.1600-0463.2003.11101161.x"
                },
                {
                    "title": "Male infertility caused by a de novo partial deletion of the DAZ cluster on the Y chromosome.",
                    "pubmedID": "11095434",
                    "doi": "10.1210/jcem.85.11.6929"
                },
                {
                    "title": "High frequency of DAZ1/DAZ2 gene deletions in patients with severe oligozoospermia.",
                    "pubmedID": "11870237",
                    "doi": "10.1093/molehr/8.3.286"
                },
                {
                    "title": "Partial DAZ deletions in a family with five infertile brothers.",
                    "pubmedID": "12801575",
                    "doi": "10.1016/s0015-0282(03)00338-8"
                },
                {
                    "title": "Copy number of DAZ genes in infertile men.",
                    "pubmedID": "16275261",
                    "doi": "10.1016/j.fertnstert.2005.06.021"
                },
                {
                    "title": "Restricted expression of the human DAZ protein in premeiotic germ cells.",
                    "pubmedID": "18385127",
                    "doi": "10.1093/humrep/den099"
                },
                {
                    "title": "Polymorphic expression of DAZ proteins in the human testis.",
                    "pubmedID": "19223287",
                    "doi": "10.1093/humrep/dep032"
                },
                {
                    "title": "Human DAZL, DAZ and BOULE genes modulate primordial germ-cell and haploid gamete formation.",
                    "pubmedID": "19865085",
                    "doi": "10.1038/nature08562"
                }
            ],
            "sequence": {
                "length": 744,
                "mass": 82764,
                "checksum": "341CB19EFC82F757",
                "modified": {
                    "$date": {
                        "$numberLong": "1078099200000"
                    }
                },
                "version": 2,
                "sequence": "MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 4224715830
        }
    ]
}