Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 1775
{
"geneID": 1775,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC009065.8"
]
},
"genePos": {
"start": 2236444,
"end": 2238711
},
"orientation": false,
"symbol": "DNASE1L2",
"created": {
"$date": {
"$numberLong": "1738333348766"
}
},
"crossReference": {
"enseGeneID": "ENSG00000167968",
"enseRnaID": [
"ENST00000567494.5"
],
"enseProtID": [
"ENSP00000455358.1"
]
},
"chrom": {
"pos": "16",
"type": 1,
"loc": "16p13.3"
},
"desc": "deoxyribonuclease 1 like 2",
"geneType": 5,
"mim": [
{
"id": 602622,
"relation": 0
}
],
"ontology": [
{
"id": "GO:0003677",
"term": "DNA binding",
"cat": 0
},
{
"id": "GO:0004530",
"term": "deoxyribonuclease I activity",
"cat": 0
},
{
"id": "GO:0004536",
"term": "DNA nuclease activity",
"pubMed": [
9205125
],
"cat": 0
},
{
"id": "GO:0005509",
"term": "calcium ion binding",
"pubMed": [
9205125
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
28514442,
33961781
],
"cat": 0
},
{
"id": "GO:0001942",
"term": "hair follicle development",
"cat": 1
},
{
"id": "GO:0003335",
"term": "corneocyte development",
"cat": 1
},
{
"id": "GO:0006259",
"term": "DNA metabolic process",
"pubMed": [
9205125
],
"cat": 1
},
{
"id": "GO:0006308",
"term": "DNA catabolic process",
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005634",
"term": "nucleus",
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
}
],
"protein": [
{
"symbol": "DNSL2_HUMAN",
"name": "Deoxyribonuclease-1-like 2",
"accession": [
"Q92874",
"E9PBY4",
"Q6JVM2",
"Q6JVM3"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"ChEBI": [
"CHEBI:18420",
"CHEBI:29108"
],
"EC": [
"3.1.21.-"
],
"EMBL": [
"U62647",
"AY298957",
"AY298958",
"AY298958",
"AK098028",
"AC009065",
"CH471112",
"CH471112",
"CH471112",
"CH471112",
"BC035205",
"BC063710"
],
"CCDS": [
"CCDS42105.1"
],
"RefSeq": [
"NP_001288609.1",
"NP_001365.1"
],
"AlphaFoldDB": [
"Q92874"
],
"SMR": [
"Q92874"
],
"BioGRID": [
"108114"
],
"IntAct": [
"Q92874"
],
"STRING": [
"9606.ENSP00000454562"
],
"iPTMnet": [
"Q92874"
],
"PhosphoSitePlus": [
"Q92874"
],
"BioMuta": [
"DNASE1L2"
],
"DMDM": [
"2494172"
],
"jPOST": [
"Q92874"
],
"MassIVE": [
"Q92874"
],
"PaxDb": [
"9606-ENSP00000454562"
],
"PeptideAtlas": [
"Q92874"
],
"ProteomicsDB": [
"66528",
"75558"
],
"Antibodypedia": [
"51835"
],
"DNASU": [
"1775"
],
"Ensembl": [
"ENST00000320700.10",
"ENST00000382437.8",
"ENST00000564065.5",
"ENST00000567494.5",
"ENST00000613572.4"
],
"KEGG": [
"hsa:1775"
],
"MANE-Select": [
"ENST00000320700.10"
],
"UCSC": [
"uc002cpn.4"
],
"AGR": [
"HGNC:2958"
],
"CTD": [
"1775"
],
"DisGeNET": [
"1775"
],
"GeneCards": [
"DNASE1L2"
],
"HGNC": [
"HGNC:2958"
],
"HPA": [
"ENSG00000167968"
],
"MIM": [
"602622"
],
"neXtProt": [
"NX_Q92874"
],
"OpenTargets": [
"ENSG00000167968"
],
"PharmGKB": [
"PA27429"
],
"VEuPathDB": [
"HostDB:ENSG00000167968"
],
"eggNOG": [
"ENOG502SGB6"
],
"GeneTree": [
"ENSGT00950000182846"
],
"HOGENOM": [
"CLU_043335_2_1_1"
],
"InParanoid": [
"Q92874"
],
"OMA": [
"DCSYVRE"
],
"OrthoDB": [
"5396078at2759"
],
"PhylomeDB": [
"Q92874"
],
"TreeFam": [
"TF329541"
],
"PathwayCommons": [
"Q92874"
],
"SignaLink": [
"Q92874"
],
"BioGRID-ORCS": [
"1775"
],
"ChiTaRS": [
"DNASE1L2"
],
"GeneWiki": [
"DNASE1L2"
],
"GenomeRNAi": [
"1775"
],
"Pharos": [
"Q92874"
],
"PRO": [
"PR:Q92874"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"Q92874"
],
"Bgee": [
"ENSG00000167968"
],
"ExpressionAtlas": [
"Q92874"
],
"GO": [
"GO:0005737",
"GO:0005576",
"GO:0005634",
"GO:0005509",
"GO:0004530",
"GO:0003677",
"GO:0004536",
"GO:0003335",
"GO:0006308",
"GO:0006259",
"GO:0001942"
],
"CDD": [
"cd10282"
],
"Gene3D": [
"3.60.10.10"
],
"InterPro": [
"IPR018057",
"IPR016202",
"IPR033125",
"IPR036691",
"IPR005135"
],
"PANTHER": [
"PTHR11371",
"PTHR11371:SF29"
],
"Pfam": [
"PF03372"
],
"PIRSF": [
"PIRSF000988"
],
"PRINTS": [
"PR00130"
],
"SMART": [
"SM00476"
],
"SUPFAM": [
"SSF56219"
],
"PROSITE": [
"PS00919",
"PS00918"
]
},
"citations": [
{
"title": "Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I.",
"pubmedID": "9205125",
"doi": "10.1006/geno.1997.4748"
},
{
"title": "Characterization of the human DNAS1L2 gene and the molecular mechanism for its transcriptional activation induced by inflammatory cytokines.",
"pubmedID": "15203207",
"doi": "10.1016/j.ygeno.2004.02.003"
},
{
"title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
"pubmedID": "14702039",
"doi": "10.1038/ng1285"
},
{
"title": "The sequence and analysis of duplication-rich human chromosome 16.",
"pubmedID": "15616553",
"doi": "10.1038/nature03187"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "DNase1L2 degrades nuclear DNA during corneocyte formation.",
"pubmedID": "16902420",
"doi": "10.1038/sj.jid.5700503"
}
],
"sequence": {
"length": 299,
"mass": 32853,
"checksum": "1B66A5590D33D0A6",
"modified": {
"$date": {
"$numberLong": "854755200000"
}
},
"version": 1,
"sequence": "MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR"
},
"existence": 0,
"relevance": 1,
"proteinID": 2715500304
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}