A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.

---

AI-Generated Summary

Raw Database JSON for Gene ID: 2578

{
    "geneID": 2578,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "protein": [
            "Q13070.1"
        ]
    },
    "symbol": "GAGE6",
    "created": {
        "$date": {
            "$numberLong": "1738333348815"
        }
    },
    "crossReference": {
        "bulk": [
            {
                "dbName": "MIM",
                "value": "300599"
            }
        ]
    },
    "chrom": {
        "loc": "Xp11.4-p11.2"
    },
    "desc": "G antigen 6",
    "geneType": 5,
    "mim": [
        {
            "id": 300599,
            "relation": 0
        }
    ],
    "protein": [
        {
            "symbol": "GAGE6_HUMAN",
            "name": "G antigen 6",
            "accession": [
                "Q13070"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "U19147"
                ],
                "RefSeq": [
                    "NP_001467.1"
                ],
                "AlphaFoldDB": [
                    "Q13070"
                ],
                "BioGRID": [
                    "108851"
                ],
                "iPTMnet": [
                    "Q13070"
                ],
                "PhosphoSitePlus": [
                    "Q13070"
                ],
                "BioMuta": [
                    "HGNC:4103"
                ],
                "jPOST": [
                    "Q13070"
                ],
                "MassIVE": [
                    "Q13070"
                ],
                "PeptideAtlas": [
                    "Q13070"
                ],
                "Pumba": [
                    "Q13070"
                ],
                "DNASU": [
                    "2578"
                ],
                "KEGG": [
                    "hsa:2578"
                ],
                "AGR": [
                    "HGNC:4103"
                ],
                "CTD": [
                    "2578"
                ],
                "DisGeNET": [
                    "2578"
                ],
                "GeneCards": [
                    "GAGE6"
                ],
                "HGNC": [
                    "HGNC:4103"
                ],
                "MIM": [
                    "300599"
                ],
                "neXtProt": [
                    "NX_Q13070"
                ],
                "PharmGKB": [
                    "PA28518"
                ],
                "InParanoid": [
                    "Q13070"
                ],
                "PathwayCommons": [
                    "Q13070"
                ],
                "SignaLink": [
                    "Q13070"
                ],
                "BioGRID-ORCS": [
                    "2578"
                ],
                "GenomeRNAi": [
                    "2578"
                ],
                "Pharos": [
                    "Q13070"
                ],
                "PRO": [
                    "PR:Q13070"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "Q13070"
                ],
                "InterPro": [
                    "IPR031320",
                    "IPR008625"
                ],
                "PANTHER": [
                    "PTHR14047:SF30",
                    "PTHR14047"
                ],
                "Pfam": [
                    "PF05831"
                ],
                "SMART": [
                    "SM01379"
                ]
            },
            "citations": [
                {
                    "title": "A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.",
                    "pubmedID": "7544395",
                    "doi": "10.1084/jem.182.3.689"
                },
                {
                    "title": "Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.",
                    "pubmedID": "10397259"
                },
                {
                    "title": "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.",
                    "pubmedID": "18179644",
                    "doi": "10.1111/j.1399-0039.2007.00997.x"
                }
            ],
            "sequence": {
                "length": 117,
                "mass": 12892,
                "checksum": "234A865E3FCCCD06",
                "modified": {
                    "$date": {
                        "$numberLong": "846806400000"
                    }
                },
                "version": 1,
                "sequence": "MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 1003299346
        }
    ]
}