Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 266

{
    "geneID": 266,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC011297.3"
        ]
    },
    "symbol": "AMELY",
    "created": {
        "$date": {
            "$numberLong": "1738333348650"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000099721",
        "enseRnaID": [
            "ENST00000651267.2"
        ],
        "enseProtID": [
            "ENSP00000498344.1"
        ]
    },
    "genePos": {
        "end": 50834,
        "start": 5000
    },
    "chrom": {
        "loc": "Yp11.2"
    },
    "desc": "amelogenin Y-linked",
    "geneType": 5,
    "mim": [
        {
            "id": 410000,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                32296183
            ],
            "cat": 0
        },
        {
            "id": "GO:0030345",
            "term": "structural constituent of tooth enamel",
            "cat": 0
        },
        {
            "id": "GO:0030345",
            "term": "structural constituent of tooth enamel",
            "pubMed": [
                1734713
            ],
            "cat": 0
        },
        {
            "id": "GO:0070166",
            "term": "enamel mineralization",
            "cat": 1
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "cat": 2
        },
        {
            "id": "GO:0062023",
            "term": "collagen-containing extracellular matrix",
            "cat": 2
        },
        {
            "id": "GO:0062023",
            "term": "collagen-containing extracellular matrix",
            "pubMed": [
                1734713
            ],
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "AMELY_HUMAN",
            "name": "Amelogenin, Y isoform",
            "accession": [
                "Q99218",
                "Q6RWT1"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "M86933",
                    "AY487421",
                    "BC069138",
                    "BC074976",
                    "BC074977",
                    "M55419",
                    "X14439"
                ],
                "CCDS": [
                    "CCDS14778.1",
                    "CCDS94708.1"
                ],
                "PIR": [
                    "F41816"
                ],
                "RefSeq": [
                    "NP_001134.1",
                    "XP_016885531.1"
                ],
                "AlphaFoldDB": [
                    "Q99218"
                ],
                "BioGRID": [
                    "106763"
                ],
                "IntAct": [
                    "Q99218"
                ],
                "STRING": [
                    "9606.ENSP00000372505"
                ],
                "BioMuta": [
                    "AMELY"
                ],
                "DMDM": [
                    "85681286"
                ],
                "Antibodypedia": [
                    "5353"
                ],
                "DNASU": [
                    "266"
                ],
                "Ensembl": [
                    "ENST00000383036.1",
                    "ENST00000651267.2"
                ],
                "KEGG": [
                    "hsa:266"
                ],
                "MANE-Select": [
                    "ENST00000651267.2"
                ],
                "UCSC": [
                    "uc004fqz.3"
                ],
                "AGR": [
                    "HGNC:462"
                ],
                "CTD": [
                    "266"
                ],
                "DisGeNET": [
                    "266"
                ],
                "GeneCards": [
                    "AMELY"
                ],
                "HGNC": [
                    "HGNC:462"
                ],
                "HPA": [
                    "ENSG00000099721"
                ],
                "MIM": [
                    "410000"
                ],
                "neXtProt": [
                    "NX_Q99218"
                ],
                "OpenTargets": [
                    "ENSG00000099721"
                ],
                "PharmGKB": [
                    "PA24767"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000099721"
                ],
                "GeneTree": [
                    "ENSGT01040000241139"
                ],
                "HOGENOM": [
                    "CLU_120753_0_0_1"
                ],
                "InParanoid": [
                    "Q99218"
                ],
                "OMA": [
                    "AGEHPMQ"
                ],
                "OrthoDB": [
                    "4520512at2759"
                ],
                "PhylomeDB": [
                    "Q99218"
                ],
                "TreeFam": [
                    "TF337092"
                ],
                "PathwayCommons": [
                    "Q99218"
                ],
                "SignaLink": [
                    "Q99218"
                ],
                "BioGRID-ORCS": [
                    "266"
                ],
                "GeneWiki": [
                    "AMELY"
                ],
                "GenomeRNAi": [
                    "266"
                ],
                "Pharos": [
                    "Q99218"
                ],
                "PRO": [
                    "PR:Q99218"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "Q99218"
                ],
                "Bgee": [
                    "ENSG00000099721"
                ],
                "GO": [
                    "GO:0062023",
                    "GO:0005576",
                    "GO:0030345",
                    "GO:0070166"
                ],
                "InterPro": [
                    "IPR004116"
                ],
                "PANTHER": [
                    "PTHR46794",
                    "PTHR46794:SF6"
                ],
                "Pfam": [
                    "PF02948"
                ],
                "PRINTS": [
                    "PR01757"
                ],
                "SMART": [
                    "SM00818"
                ]
            },
            "citations": [
                {
                    "title": "The human enamel protein gene amelogenin is expressed from both the X and the Y chromosomes.",
                    "pubmedID": "1734713"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "A human X-Y homologous region encodes 'amelogenin'.",
                    "pubmedID": "2004775",
                    "doi": "10.1016/0888-7543(91)90251-9"
                }
            ],
            "sequence": {
                "length": 206,
                "mass": 23250,
                "checksum": "9324AB50546DB4D5",
                "modified": {
                    "$date": {
                        "$numberLong": "1138060800000"
                    }
                },
                "version": 2,
                "sequence": "MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 1082520267
        }
    ]
}