Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 266
{
"geneID": 266,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC011297.3"
]
},
"symbol": "AMELY",
"created": {
"$date": {
"$numberLong": "1738333348650"
}
},
"crossReference": {
"enseGeneID": "ENSG00000099721",
"enseRnaID": [
"ENST00000651267.2"
],
"enseProtID": [
"ENSP00000498344.1"
]
},
"genePos": {
"end": 50834,
"start": 5000
},
"chrom": {
"loc": "Yp11.2"
},
"desc": "amelogenin Y-linked",
"geneType": 5,
"mim": [
{
"id": 410000,
"relation": 0
}
],
"ontology": [
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
32296183
],
"cat": 0
},
{
"id": "GO:0030345",
"term": "structural constituent of tooth enamel",
"cat": 0
},
{
"id": "GO:0030345",
"term": "structural constituent of tooth enamel",
"pubMed": [
1734713
],
"cat": 0
},
{
"id": "GO:0070166",
"term": "enamel mineralization",
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0062023",
"term": "collagen-containing extracellular matrix",
"cat": 2
},
{
"id": "GO:0062023",
"term": "collagen-containing extracellular matrix",
"pubMed": [
1734713
],
"cat": 2
}
],
"protein": [
{
"symbol": "AMELY_HUMAN",
"name": "Amelogenin, Y isoform",
"accession": [
"Q99218",
"Q6RWT1"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"M86933",
"AY487421",
"BC069138",
"BC074976",
"BC074977",
"M55419",
"X14439"
],
"CCDS": [
"CCDS14778.1",
"CCDS94708.1"
],
"PIR": [
"F41816"
],
"RefSeq": [
"NP_001134.1",
"XP_016885531.1"
],
"AlphaFoldDB": [
"Q99218"
],
"BioGRID": [
"106763"
],
"IntAct": [
"Q99218"
],
"STRING": [
"9606.ENSP00000372505"
],
"BioMuta": [
"AMELY"
],
"DMDM": [
"85681286"
],
"Antibodypedia": [
"5353"
],
"DNASU": [
"266"
],
"Ensembl": [
"ENST00000383036.1",
"ENST00000651267.2"
],
"KEGG": [
"hsa:266"
],
"MANE-Select": [
"ENST00000651267.2"
],
"UCSC": [
"uc004fqz.3"
],
"AGR": [
"HGNC:462"
],
"CTD": [
"266"
],
"DisGeNET": [
"266"
],
"GeneCards": [
"AMELY"
],
"HGNC": [
"HGNC:462"
],
"HPA": [
"ENSG00000099721"
],
"MIM": [
"410000"
],
"neXtProt": [
"NX_Q99218"
],
"OpenTargets": [
"ENSG00000099721"
],
"PharmGKB": [
"PA24767"
],
"VEuPathDB": [
"HostDB:ENSG00000099721"
],
"GeneTree": [
"ENSGT01040000241139"
],
"HOGENOM": [
"CLU_120753_0_0_1"
],
"InParanoid": [
"Q99218"
],
"OMA": [
"AGEHPMQ"
],
"OrthoDB": [
"4520512at2759"
],
"PhylomeDB": [
"Q99218"
],
"TreeFam": [
"TF337092"
],
"PathwayCommons": [
"Q99218"
],
"SignaLink": [
"Q99218"
],
"BioGRID-ORCS": [
"266"
],
"GeneWiki": [
"AMELY"
],
"GenomeRNAi": [
"266"
],
"Pharos": [
"Q99218"
],
"PRO": [
"PR:Q99218"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"Q99218"
],
"Bgee": [
"ENSG00000099721"
],
"GO": [
"GO:0062023",
"GO:0005576",
"GO:0030345",
"GO:0070166"
],
"InterPro": [
"IPR004116"
],
"PANTHER": [
"PTHR46794",
"PTHR46794:SF6"
],
"Pfam": [
"PF02948"
],
"PRINTS": [
"PR01757"
],
"SMART": [
"SM00818"
]
},
"citations": [
{
"title": "The human enamel protein gene amelogenin is expressed from both the X and the Y chromosomes.",
"pubmedID": "1734713"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "A human X-Y homologous region encodes 'amelogenin'.",
"pubmedID": "2004775",
"doi": "10.1016/0888-7543(91)90251-9"
}
],
"sequence": {
"length": 206,
"mass": 23250,
"checksum": "9324AB50546DB4D5",
"modified": {
"$date": {
"$numberLong": "1138060800000"
}
},
"version": 2,
"sequence": "MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD"
},
"existence": 0,
"relevance": 1,
"proteinID": 1082520267
}
]
}