Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 3233

{
    "geneID": 3233,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC009336.13"
        ]
    },
    "genePos": {
        "start": 176637994,
        "end": 176641368
    },
    "orientation": true,
    "symbol": "HOXD4",
    "created": {
        "$date": {
            "$numberLong": "1738333348927"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000170166",
        "enseRnaID": [
            "ENST00000306324.4"
        ],
        "enseProtID": [
            "ENSP00000302548.3"
        ]
    },
    "chrom": {
        "pos": "2",
        "type": 1,
        "loc": "2q31.1"
    },
    "desc": "homeobox D4",
    "geneType": 5,
    "mim": [
        {
            "id": 142981,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-1266738",
            "term": "Developmental Biology",
            "cat": 10
        },
        {
            "id": "R-HSA-5619507",
            "term": "Activation of HOX genes during differentiation",
            "cat": 11
        },
        {
            "id": "R-HSA-5617472",
            "term": "Activation of anterior HOX genes in hindbrain development during early embryogenesis",
            "cat": 12
        },
        {
            "id": "GO:0000977",
            "term": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
            "pubMed": [
                1756725
            ],
            "cat": 0
        },
        {
            "id": "GO:0000978",
            "term": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
            "cat": 0
        },
        {
            "id": "GO:0000981",
            "term": "DNA-binding transcription factor activity, RNA polymerase II-specific",
            "cat": 0
        },
        {
            "id": "GO:0001228",
            "term": "DNA-binding transcription activator activity, RNA polymerase II-specific",
            "pubMed": [
                1756725
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                32296183
            ],
            "cat": 0
        },
        {
            "id": "GO:1990837",
            "term": "sequence-specific double-stranded DNA binding",
            "pubMed": [
                28473536
            ],
            "cat": 0
        },
        {
            "id": "GO:0009952",
            "term": "anterior/posterior pattern specification",
            "cat": 1
        },
        {
            "id": "GO:0045944",
            "term": "positive regulation of transcription by RNA polymerase II",
            "cat": 1
        },
        {
            "id": "GO:0045944",
            "term": "positive regulation of transcription by RNA polymerase II",
            "pubMed": [
                1756725
            ],
            "cat": 1
        },
        {
            "id": "GO:0048568",
            "term": "embryonic organ development",
            "pubMed": [
                2879245
            ],
            "cat": 1
        },
        {
            "id": "GO:0048704",
            "term": "embryonic skeletal system morphogenesis",
            "cat": 1
        },
        {
            "id": "GO:0048863",
            "term": "stem cell differentiation",
            "cat": 1
        },
        {
            "id": "GO:0000785",
            "term": "chromatin",
            "cat": 2
        },
        {
            "id": "GO:0005654",
            "term": "nucleoplasm",
            "cat": 2
        },
        {
            "id": "GO:0030054",
            "term": "cell junction",
            "cat": 2
        }
    ],
    "geneRelations": [
        {
            "type": 6,
            "similarGenes": [
                "3230"
            ]
        }
    ],
    "protein": [
        {
            "symbol": "HXD4_HUMAN",
            "name": "Homeobox protein Hox-D4",
            "accession": [
                "P09016",
                "B2R9R3",
                "Q96AU0"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "X17360",
                    "X04706",
                    "AK313885",
                    "BC016763",
                    "BC074797"
                ],
                "CCDS": [
                    "CCDS2269.1"
                ],
                "PIR": [
                    "S10985"
                ],
                "RefSeq": [
                    "NP_055436.2"
                ],
                "AlphaFoldDB": [
                    "P09016"
                ],
                "SMR": [
                    "P09016"
                ],
                "BioGRID": [
                    "109473"
                ],
                "ELM": [
                    "P09016"
                ],
                "IntAct": [
                    "P09016"
                ],
                "STRING": [
                    "9606.ENSP00000302548"
                ],
                "iPTMnet": [
                    "P09016"
                ],
                "PhosphoSitePlus": [
                    "P09016"
                ],
                "BioMuta": [
                    "HOXD4"
                ],
                "DMDM": [
                    "20141491"
                ],
                "MassIVE": [
                    "P09016"
                ],
                "PaxDb": [
                    "9606-ENSP00000302548"
                ],
                "PeptideAtlas": [
                    "P09016"
                ],
                "ProteomicsDB": [
                    "52185"
                ],
                "Pumba": [
                    "P09016"
                ],
                "Antibodypedia": [
                    "19523"
                ],
                "DNASU": [
                    "3233"
                ],
                "Ensembl": [
                    "ENST00000306324.4"
                ],
                "KEGG": [
                    "hsa:3233"
                ],
                "MANE-Select": [
                    "ENST00000306324.4"
                ],
                "UCSC": [
                    "uc002uks.4"
                ],
                "AGR": [
                    "HGNC:5138"
                ],
                "CTD": [
                    "3233"
                ],
                "DisGeNET": [
                    "3233"
                ],
                "GeneCards": [
                    "HOXD4"
                ],
                "HGNC": [
                    "HGNC:5138"
                ],
                "HPA": [
                    "ENSG00000170166"
                ],
                "MIM": [
                    "142981"
                ],
                "neXtProt": [
                    "NX_P09016"
                ],
                "OpenTargets": [
                    "ENSG00000170166"
                ],
                "PharmGKB": [
                    "PA29412"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000170166"
                ],
                "eggNOG": [
                    "KOG0489"
                ],
                "GeneTree": [
                    "ENSGT00940000157270"
                ],
                "HOGENOM": [
                    "CLU_061398_0_0_1"
                ],
                "InParanoid": [
                    "P09016"
                ],
                "OMA": [
                    "QGVYPRS"
                ],
                "OrthoDB": [
                    "728401at2759"
                ],
                "PhylomeDB": [
                    "P09016"
                ],
                "TreeFam": [
                    "TF352857"
                ],
                "PathwayCommons": [
                    "P09016"
                ],
                "Reactome": [
                    "R-HSA-5617472"
                ],
                "SignaLink": [
                    "P09016"
                ],
                "BioGRID-ORCS": [
                    "3233"
                ],
                "GeneWiki": [
                    "HOXD4"
                ],
                "GenomeRNAi": [
                    "3233"
                ],
                "Pharos": [
                    "P09016"
                ],
                "PRO": [
                    "PR:P09016"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P09016"
                ],
                "Bgee": [
                    "ENSG00000170166"
                ],
                "GO": [
                    "GO:0030054",
                    "GO:0000785",
                    "GO:0005654",
                    "GO:0001228",
                    "GO:0000981",
                    "GO:0000978",
                    "GO:0000977",
                    "GO:1990837",
                    "GO:0009952",
                    "GO:0048568",
                    "GO:0048704",
                    "GO:0045944",
                    "GO:0048863"
                ],
                "CDD": [
                    "cd00086"
                ],
                "Gene3D": [
                    "1.10.10.60"
                ],
                "InterPro": [
                    "IPR050609",
                    "IPR001356",
                    "IPR020479",
                    "IPR017995",
                    "IPR001827",
                    "IPR017970",
                    "IPR009057"
                ],
                "PANTHER": [
                    "PTHR45771:SF5",
                    "PTHR45771"
                ],
                "Pfam": [
                    "PF00046"
                ],
                "PRINTS": [
                    "PR00025",
                    "PR00024"
                ],
                "SMART": [
                    "SM00389"
                ],
                "SUPFAM": [
                    "SSF46689"
                ],
                "PROSITE": [
                    "PS00032",
                    "PS00027",
                    "PS50071"
                ]
            },
            "citations": [
                {
                    "title": "Molecular mechanisms underlying the expression of the human HOX-5.1 gene.",
                    "pubmedID": "1975093",
                    "doi": "10.1093/nar/18.15.4361"
                },
                {
                    "title": "Differential and stage-related expression in embryonic tissues of a new human homoeobox gene.",
                    "pubmedID": "2879245",
                    "doi": "10.1038/324664a0"
                },
                {
                    "title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
                    "pubmedID": "14702039",
                    "doi": "10.1038/ng1285"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Organization of human class I homeobox genes.",
                    "pubmedID": "2576652",
                    "doi": "10.1139/g89-133"
                },
                {
                    "title": "Both Pbx1 and E2A-Pbx1 bind the DNA motif ATCAATCAA cooperatively with the products of multiple murine Hox genes, some of which are themselves oncogenes.",
                    "pubmedID": "7791786",
                    "doi": "10.1128/mcb.15.7.3786"
                }
            ],
            "sequence": {
                "length": 255,
                "mass": 27885,
                "checksum": "39205343CDB0142F",
                "modified": {
                    "$date": {
                        "$numberLong": "1011744000000"
                    }
                },
                "version": 3,
                "sequence": "MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 1201085333
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}