Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 3233
{
"geneID": 3233,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC009336.13"
]
},
"genePos": {
"start": 176637994,
"end": 176641368
},
"orientation": true,
"symbol": "HOXD4",
"created": {
"$date": {
"$numberLong": "1738333348927"
}
},
"crossReference": {
"enseGeneID": "ENSG00000170166",
"enseRnaID": [
"ENST00000306324.4"
],
"enseProtID": [
"ENSP00000302548.3"
]
},
"chrom": {
"pos": "2",
"type": 1,
"loc": "2q31.1"
},
"desc": "homeobox D4",
"geneType": 5,
"mim": [
{
"id": 142981,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-1266738",
"term": "Developmental Biology",
"cat": 10
},
{
"id": "R-HSA-5619507",
"term": "Activation of HOX genes during differentiation",
"cat": 11
},
{
"id": "R-HSA-5617472",
"term": "Activation of anterior HOX genes in hindbrain development during early embryogenesis",
"cat": 12
},
{
"id": "GO:0000977",
"term": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
"pubMed": [
1756725
],
"cat": 0
},
{
"id": "GO:0000978",
"term": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
"cat": 0
},
{
"id": "GO:0000981",
"term": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"cat": 0
},
{
"id": "GO:0001228",
"term": "DNA-binding transcription activator activity, RNA polymerase II-specific",
"pubMed": [
1756725
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
32296183
],
"cat": 0
},
{
"id": "GO:1990837",
"term": "sequence-specific double-stranded DNA binding",
"pubMed": [
28473536
],
"cat": 0
},
{
"id": "GO:0009952",
"term": "anterior/posterior pattern specification",
"cat": 1
},
{
"id": "GO:0045944",
"term": "positive regulation of transcription by RNA polymerase II",
"cat": 1
},
{
"id": "GO:0045944",
"term": "positive regulation of transcription by RNA polymerase II",
"pubMed": [
1756725
],
"cat": 1
},
{
"id": "GO:0048568",
"term": "embryonic organ development",
"pubMed": [
2879245
],
"cat": 1
},
{
"id": "GO:0048704",
"term": "embryonic skeletal system morphogenesis",
"cat": 1
},
{
"id": "GO:0048863",
"term": "stem cell differentiation",
"cat": 1
},
{
"id": "GO:0000785",
"term": "chromatin",
"cat": 2
},
{
"id": "GO:0005654",
"term": "nucleoplasm",
"cat": 2
},
{
"id": "GO:0030054",
"term": "cell junction",
"cat": 2
}
],
"geneRelations": [
{
"type": 6,
"similarGenes": [
"3230"
]
}
],
"protein": [
{
"symbol": "HXD4_HUMAN",
"name": "Homeobox protein Hox-D4",
"accession": [
"P09016",
"B2R9R3",
"Q96AU0"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"X17360",
"X04706",
"AK313885",
"BC016763",
"BC074797"
],
"CCDS": [
"CCDS2269.1"
],
"PIR": [
"S10985"
],
"RefSeq": [
"NP_055436.2"
],
"AlphaFoldDB": [
"P09016"
],
"SMR": [
"P09016"
],
"BioGRID": [
"109473"
],
"ELM": [
"P09016"
],
"IntAct": [
"P09016"
],
"STRING": [
"9606.ENSP00000302548"
],
"iPTMnet": [
"P09016"
],
"PhosphoSitePlus": [
"P09016"
],
"BioMuta": [
"HOXD4"
],
"DMDM": [
"20141491"
],
"MassIVE": [
"P09016"
],
"PaxDb": [
"9606-ENSP00000302548"
],
"PeptideAtlas": [
"P09016"
],
"ProteomicsDB": [
"52185"
],
"Pumba": [
"P09016"
],
"Antibodypedia": [
"19523"
],
"DNASU": [
"3233"
],
"Ensembl": [
"ENST00000306324.4"
],
"KEGG": [
"hsa:3233"
],
"MANE-Select": [
"ENST00000306324.4"
],
"UCSC": [
"uc002uks.4"
],
"AGR": [
"HGNC:5138"
],
"CTD": [
"3233"
],
"DisGeNET": [
"3233"
],
"GeneCards": [
"HOXD4"
],
"HGNC": [
"HGNC:5138"
],
"HPA": [
"ENSG00000170166"
],
"MIM": [
"142981"
],
"neXtProt": [
"NX_P09016"
],
"OpenTargets": [
"ENSG00000170166"
],
"PharmGKB": [
"PA29412"
],
"VEuPathDB": [
"HostDB:ENSG00000170166"
],
"eggNOG": [
"KOG0489"
],
"GeneTree": [
"ENSGT00940000157270"
],
"HOGENOM": [
"CLU_061398_0_0_1"
],
"InParanoid": [
"P09016"
],
"OMA": [
"QGVYPRS"
],
"OrthoDB": [
"728401at2759"
],
"PhylomeDB": [
"P09016"
],
"TreeFam": [
"TF352857"
],
"PathwayCommons": [
"P09016"
],
"Reactome": [
"R-HSA-5617472"
],
"SignaLink": [
"P09016"
],
"BioGRID-ORCS": [
"3233"
],
"GeneWiki": [
"HOXD4"
],
"GenomeRNAi": [
"3233"
],
"Pharos": [
"P09016"
],
"PRO": [
"PR:P09016"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P09016"
],
"Bgee": [
"ENSG00000170166"
],
"GO": [
"GO:0030054",
"GO:0000785",
"GO:0005654",
"GO:0001228",
"GO:0000981",
"GO:0000978",
"GO:0000977",
"GO:1990837",
"GO:0009952",
"GO:0048568",
"GO:0048704",
"GO:0045944",
"GO:0048863"
],
"CDD": [
"cd00086"
],
"Gene3D": [
"1.10.10.60"
],
"InterPro": [
"IPR050609",
"IPR001356",
"IPR020479",
"IPR017995",
"IPR001827",
"IPR017970",
"IPR009057"
],
"PANTHER": [
"PTHR45771:SF5",
"PTHR45771"
],
"Pfam": [
"PF00046"
],
"PRINTS": [
"PR00025",
"PR00024"
],
"SMART": [
"SM00389"
],
"SUPFAM": [
"SSF46689"
],
"PROSITE": [
"PS00032",
"PS00027",
"PS50071"
]
},
"citations": [
{
"title": "Molecular mechanisms underlying the expression of the human HOX-5.1 gene.",
"pubmedID": "1975093",
"doi": "10.1093/nar/18.15.4361"
},
{
"title": "Differential and stage-related expression in embryonic tissues of a new human homoeobox gene.",
"pubmedID": "2879245",
"doi": "10.1038/324664a0"
},
{
"title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
"pubmedID": "14702039",
"doi": "10.1038/ng1285"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Organization of human class I homeobox genes.",
"pubmedID": "2576652",
"doi": "10.1139/g89-133"
},
{
"title": "Both Pbx1 and E2A-Pbx1 bind the DNA motif ATCAATCAA cooperatively with the products of multiple murine Hox genes, some of which are themselves oncogenes.",
"pubmedID": "7791786",
"doi": "10.1128/mcb.15.7.3786"
}
],
"sequence": {
"length": 255,
"mass": 27885,
"checksum": "39205343CDB0142F",
"modified": {
"$date": {
"$numberLong": "1011744000000"
}
},
"version": 3,
"sequence": "MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL"
},
"existence": 0,
"relevance": 1,
"proteinID": 1201085333
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}