Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Loading...
An AI-generated summary is being created for this entry. The content will appear here automatically when ready (usually within a minute).
Raw Database JSON for Gene ID: 5008
{
"geneID": 5008,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"CP068256.2"
]
},
"genePos": {
"start": 30262829,
"end": 30266851
},
"orientation": false,
"symbol": "OSM",
"created": {
"$date": {
"$numberLong": "1738333349053"
}
},
"crossReference": {
"enseGeneID": "ENSG00000099985",
"enseRnaID": [
"ENST00000403389.1"
],
"enseProtID": [
"ENSP00000383893.1"
]
},
"chrom": {
"pos": "22",
"type": 1,
"loc": "22q12.2"
},
"desc": "oncostatin M",
"geneType": 5,
"mim": [
{
"id": 165095,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-168256",
"term": "Immune System",
"cat": 10
},
{
"id": "R-HSA-1280215",
"term": "Cytokine Signaling in Immune system",
"cat": 11
},
{
"id": "R-HSA-449147",
"term": "Signaling by Interleukins",
"cat": 12
},
{
"id": "R-HSA-6783589",
"term": "Interleukin-6 family signaling",
"cat": 13
},
{
"id": "R-HSA-6785807",
"term": "Interleukin-4 and Interleukin-13 signaling",
"cat": 13
},
{
"id": "R-HSA-6788467",
"term": "IL-6-type cytokine receptor ligand interactions",
"cat": 14
},
{
"id": "GO:0005125",
"term": "cytokine activity",
"cat": 0
},
{
"id": "GO:0005125",
"term": "cytokine activity",
"pubMed": [
8999038
],
"cat": 0
},
{
"id": "GO:0005147",
"term": "oncostatin-M receptor binding",
"pubMed": [
8999038
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
16051226,
28514442,
33961781
],
"cat": 0
},
{
"id": "GO:0008083",
"term": "growth factor activity",
"pubMed": [
8999038
],
"cat": 0
},
{
"id": "GO:0002675",
"term": "positive regulation of acute inflammatory response",
"pubMed": [
8999038
],
"cat": 1
},
{
"id": "GO:0006955",
"term": "immune response",
"cat": 1
},
{
"id": "GO:0008284",
"term": "positive regulation of cell population proliferation",
"pubMed": [
8999038
],
"cat": 1
},
{
"id": "GO:0008285",
"term": "negative regulation of cell population proliferation",
"pubMed": [
1717982
],
"cat": 1
},
{
"id": "GO:0032740",
"term": "positive regulation of interleukin-17 production",
"pubMed": [
28972028
],
"cat": 1
},
{
"id": "GO:0033138",
"term": "positive regulation of peptidyl-serine phosphorylation",
"pubMed": [
7508917
],
"cat": 1
},
{
"id": "GO:0038165",
"term": "oncostatin-M-mediated signaling pathway",
"pubMed": [
8999038,
28972028
],
"cat": 1
},
{
"id": "GO:0042531",
"term": "positive regulation of tyrosine phosphorylation of STAT protein",
"pubMed": [
21912637
],
"cat": 1
},
{
"id": "GO:0043410",
"term": "positive regulation of MAPK cascade",
"pubMed": [
7508917
],
"cat": 1
},
{
"id": "GO:0045944",
"term": "positive regulation of transcription by RNA polymerase II",
"pubMed": [
7508917
],
"cat": 1
},
{
"id": "GO:0046888",
"term": "negative regulation of hormone secretion",
"pubMed": [
7867561
],
"cat": 1
},
{
"id": "GO:0050729",
"term": "positive regulation of inflammatory response",
"pubMed": [
28972028
],
"cat": 1
},
{
"id": "GO:0050731",
"term": "positive regulation of peptidyl-tyrosine phosphorylation",
"pubMed": [
7508917
],
"cat": 1
},
{
"id": "GO:0050731",
"term": "positive regulation of peptidyl-tyrosine phosphorylation",
"pubMed": [
8999038
],
"cat": 1
},
{
"id": "GO:0051781",
"term": "positive regulation of cell division",
"cat": 1
},
{
"id": "GO:0051897",
"term": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction",
"pubMed": [
28972028
],
"cat": 1
},
{
"id": "GO:1902036",
"term": "regulation of hematopoietic stem cell differentiation",
"pubMed": [
1542793
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"cat": 2
}
],
"protein": [
{
"symbol": "ONCM_HUMAN",
"name": "Oncostatin-M",
"accession": [
"P13725",
"Q6FHP8",
"Q9UCP6"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"M27288",
"M27286",
"M27287",
"CR456534",
"CR541703",
"AC004264",
"CH471095",
"BC011589"
],
"CCDS": [
"CCDS13873.1"
],
"PIR": [
"A32489"
],
"RefSeq": [
"NP_001306037.1",
"NP_065391.1"
],
"PDB": [
"1EVS"
],
"PDBsum": [
"1EVS"
],
"AlphaFoldDB": [
"P13725"
],
"BMRB": [
"P13725"
],
"SMR": [
"P13725"
],
"BioGRID": [
"111049"
],
"DIP": [
"DIP-5785N"
],
"IntAct": [
"P13725"
],
"MINT": [
"P13725"
],
"STRING": [
"9606.ENSP00000215781"
],
"GlyCosmos": [
"P13725"
],
"GlyGen": [
"P13725"
],
"iPTMnet": [
"P13725"
],
"PhosphoSitePlus": [
"P13725"
],
"BioMuta": [
"OSM"
],
"DMDM": [
"129168"
],
"MassIVE": [
"P13725"
],
"PaxDb": [
"9606-ENSP00000215781"
],
"PeptideAtlas": [
"P13725"
],
"ProteomicsDB": [
"52975"
],
"Antibodypedia": [
"10652"
],
"DNASU": [
"5008"
],
"Ensembl": [
"ENST00000215781.3"
],
"KEGG": [
"hsa:5008"
],
"MANE-Select": [
"ENST00000215781.3"
],
"UCSC": [
"uc003ahb.4"
],
"AGR": [
"HGNC:8506"
],
"CTD": [
"5008"
],
"DisGeNET": [
"5008"
],
"GeneCards": [
"OSM"
],
"HGNC": [
"HGNC:8506"
],
"HPA": [
"ENSG00000099985"
],
"MIM": [
"165095"
],
"neXtProt": [
"NX_P13725"
],
"OpenTargets": [
"ENSG00000099985"
],
"PharmGKB": [
"PA32836"
],
"VEuPathDB": [
"HostDB:ENSG00000099985"
],
"eggNOG": [
"ENOG502RVJA"
],
"GeneTree": [
"ENSGT00390000004850"
],
"HOGENOM": [
"CLU_102028_0_0_1"
],
"InParanoid": [
"P13725"
],
"OMA": [
"FMHSVGQ"
],
"OrthoDB": [
"4641001at2759"
],
"PhylomeDB": [
"P13725"
],
"TreeFam": [
"TF338204"
],
"PathwayCommons": [
"P13725"
],
"Reactome": [
"R-HSA-6785807",
"R-HSA-6788467"
],
"SignaLink": [
"P13725"
],
"SIGNOR": [
"P13725"
],
"BioGRID-ORCS": [
"5008"
],
"EvolutionaryTrace": [
"P13725"
],
"GeneWiki": [
"Oncostatin_M"
],
"GenomeRNAi": [
"5008"
],
"Pharos": [
"P13725"
],
"PRO": [
"PR:P13725"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P13725"
],
"Bgee": [
"ENSG00000099985"
],
"ExpressionAtlas": [
"P13725"
],
"GO": [
"GO:0005576",
"GO:0005615",
"GO:0005125",
"GO:0008083",
"GO:0005147",
"GO:0006955",
"GO:0008285",
"GO:0046888",
"GO:0038165",
"GO:0002675",
"GO:0051781",
"GO:0008284",
"GO:0050729",
"GO:0032740",
"GO:0043410",
"GO:0033138",
"GO:0050731",
"GO:0051897",
"GO:0045944",
"GO:0042531",
"GO:1902036"
],
"Gene3D": [
"1.20.1250.10"
],
"InterPro": [
"IPR009079",
"IPR001581",
"IPR019827",
"IPR039578"
],
"PANTHER": [
"PTHR14261",
"PTHR14261:SF0"
],
"Pfam": [
"PF01291"
],
"SMART": [
"SM00080"
],
"SUPFAM": [
"SSF47266"
],
"PROSITE": [
"PS00590"
]
},
"citations": [
{
"title": "Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M.",
"pubmedID": "2779549",
"doi": "10.1128/mcb.9.7.2847-2853.1989"
},
{
"title": "A genome annotation-driven approach to cloning the human ORFeome.",
"pubmedID": "15461802",
"doi": "10.1186/gb-2004-5-10-r84"
},
{
"title": "The DNA sequence of human chromosome 22.",
"pubmedID": "10591208",
"doi": "10.1038/990031"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Oncostatin M: a growth regulator produced by differentiated histiocytic lymphoma cells.",
"pubmedID": "3540948",
"doi": "10.1073/pnas.83.24.9739"
},
{
"title": "Identification of a major growth factor for AIDS-Kaposi's sarcoma cells as oncostatin M.",
"pubmedID": "1542792",
"doi": "10.1126/science.1542792"
},
{
"title": "Cleavage of a hydrophilic C-terminal domain increases growth-inhibitory activity of oncostatin M.",
"pubmedID": "2325640",
"doi": "10.1128/mcb.10.5.1882-1890.1990"
},
{
"title": "Disulfide bond assignment and identification of regions required for functional activity of oncostatin M.",
"pubmedID": "2026606",
"doi": "10.1016/s0021-9258(18)31534-5"
},
{
"title": "Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6.",
"pubmedID": "1717982",
"doi": "10.1073/pnas.88.19.8641"
},
{
"title": "Oncostatin M as a potent mitogen for AIDS-Kaposi's sarcoma-derived cells.",
"pubmedID": "1542793",
"doi": "10.1126/science.1542793"
},
{
"title": "Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.",
"pubmedID": "8999038",
"doi": "10.1074/jbc.271.51.32635"
},
{
"title": "Crystal structure and functional dissection of the cytostatic cytokine oncostatin M.",
"pubmedID": "10997905",
"doi": "10.1016/s0969-2126(00)00176-3"
}
],
"sequence": {
"length": 252,
"mass": 28484,
"checksum": "A5BE281175D101B9",
"modified": {
"$date": {
"$numberLong": "649468800000"
}
},
"version": 2,
"sequence": "MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR"
},
"existence": 0,
"relevance": 1,
"proteinID": 4154560572
},
{
"symbol": "B5MCX1_HUMAN",
"accession": [
"B5MCX1"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"AC004264"
],
"RefSeq": [
"NP_001306037.1"
],
"AlphaFoldDB": [
"B5MCX1"
],
"SMR": [
"B5MCX1"
],
"MassIVE": [
"B5MCX1"
],
"PeptideAtlas": [
"B5MCX1",
"B5MCX1"
],
"ProteomicsDB": [
"6118",
"B5MCX1"
],
"Antibodypedia": [
"10652"
],
"DNASU": [
"5008"
],
"Ensembl": [
"ENST00000403389.1",
"ENSP00000383893.1"
],
"UCSC": [
"uc062dan.1"
],
"CTD": [
"5008"
],
"DisGeNET": [
"5008"
],
"HGNC": [
"HGNC:8506"
],
"VEuPathDB": [
"HostDB:ENSG00000099985"
],
"GeneTree": [
"ENSGT00390000004850"
],
"OrthoDB": [
"4641001at2759"
],
"BioGRID-ORCS": [
"5008"
],
"Proteomes": [
"UP000005640",
"UP000005640"
],
"Bgee": [
"ENSG00000099985"
],
"ExpressionAtlas": [
"B5MCX1"
],
"GO": [
"GO:0005576",
"GO:0005125",
"GO:0005147",
"GO:0006955",
"GO:0038165",
"GO:0010646",
"GO:0023051"
],
"Gene3D": [
"1.20.1250.10"
],
"InterPro": [
"IPR009079",
"IPR001581",
"IPR019827",
"IPR039578"
],
"PANTHER": [
"PTHR14261",
"PTHR14261:SF0"
],
"Pfam": [
"PF01291"
],
"SMART": [
"SM00080"
],
"SUPFAM": [
"SSF47266"
],
"PROSITE": [
"PS00590"
],
"ARBA": [
"ARBA00004613",
"ARBA00005971",
"ARBA00022525",
"ARBA00022729"
],
"SAM": [
"MobiDB-lite"
]
},
"citations": [
{
"title": "The DNA sequence of human chromosome 22.",
"pubmedID": "10591208",
"doi": "10.1038/990031"
},
{
"title": "Initial sequencing and analysis of the human genome.",
"pubmedID": "11237011",
"doi": "10.1038/35057062"
},
{
"title": "Finishing the euchromatic sequence of the human genome.",
"pubmedID": "15496913",
"doi": "10.1038/nature03001"
},
{
"title": "Finishing the finished human chromosome 22 sequence.",
"pubmedID": "18477386",
"doi": "10.1186/gb-2008-9-5-r78"
}
],
"sequence": {
"length": 231,
"mass": 26216,
"checksum": "2554E3AFA63FBA08",
"modified": {
"$date": {
"$numberLong": "1223942400000"
}
},
"version": 1,
"sequence": "MASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR"
},
"existence": 0,
"relevance": 2,
"proteinID": 3499601832
}
],
"mRNAExpressions": {
"proteinAtlas": [
{
"l": "Granulocytes",
"c": "basophil",
"e": 65.5
},
{
"l": "Granulocytes",
"c": "neutrophil",
"e": 35
}
]
},
"singleCellExpressions": {
"cellSignificanceIndex": [
{
"cell_id": "CL0000861",
"cell_term": "elicited macrophage",
"context": "overall",
"pVal": 0.4272465302337993,
"deltaVal": 1,
"csiScore": 13.63609991941982,
"rCsiScore": 12.51996103085925,
"prsScore": 95.1022
},
{
"cell_id": "CL0000129",
"cell_term": "microglial cell",
"context": "overall",
"pVal": 0.3501940285594085,
"deltaVal": 1,
"csiScore": 8.943654952655663,
"rCsiScore": 35.99910522265489,
"prsScore": 89.7959
},
{
"cell_id": "CL0000766",
"cell_term": "myeloid leukocyte",
"context": "overall",
"pVal": 0.5506732115487685,
"deltaVal": 1,
"csiScore": 7.387480567276879,
"rCsiScore": 6.815768244092118,
"prsScore": 92.2239
},
{
"cell_id": "CL0000037",
"cell_term": "hematopoietic stem cell",
"context": "overall",
"pVal": 0.6818725676785036,
"deltaVal": 1,
"csiScore": 3.5889017027338714,
"rCsiScore": 2.3854248485662835,
"prsScore": 92.5335
},
{
"cell_id": "CL0001054",
"cell_term": "CD14-positive monocyte",
"context": "overall",
"pVal": 0.6457684686285381,
"deltaVal": 1,
"csiScore": 3.555303070337684,
"rCsiScore": 4.428102327424326,
"prsScore": 96.051
},
{
"cell_id": "CL0002397",
"cell_term": "CD14-positive, CD16-positive monocyte",
"context": "overall",
"pVal": 0.6462166916901149,
"deltaVal": 1,
"csiScore": 3.3352391369195593,
"rCsiScore": 4.3701134659556535,
"prsScore": 96.4112
},
{
"cell_id": "CL0000049",
"cell_term": "common myeloid progenitor",
"context": "overall",
"pVal": 0.7032494033986314,
"deltaVal": 1,
"csiScore": 3.055836195864484,
"rCsiScore": 2.470848938384532,
"prsScore": 92.1941
},
{
"cell_id": "CL0000094",
"cell_term": "granulocyte",
"context": "overall",
"pVal": 0.6597954486258084,
"deltaVal": 1,
"csiScore": 3.0097486895605745,
"rCsiScore": 4.598415201610097,
"prsScore": 94.6998
},
{
"cell_id": "CL0000451",
"cell_term": "dendritic cell",
"context": "overall",
"pVal": 0.6734056667746238,
"deltaVal": 1,
"csiScore": 2.922944625407166,
"rCsiScore": 3.6013752059662467,
"prsScore": 90.7591
},
{
"cell_id": "CL0002399",
"cell_term": "CD1c-positive myeloid dendritic cell",
"context": "overall",
"pVal": 0.6425087777429241,
"deltaVal": 1,
"csiScore": 2.721049086803217,
"rCsiScore": 3.2866494044437387,
"prsScore": 95.229
},
{
"cell_id": "CL0002396",
"cell_term": "CD14-low, CD16-positive monocyte",
"context": "overall",
"pVal": 0.7161768905723553,
"deltaVal": 1,
"csiScore": 2.679232998014129,
"rCsiScore": 2.064237211952901,
"prsScore": 93.8992
},
{
"cell_id": "CL0000775",
"cell_term": "neutrophil",
"context": "overall",
"pVal": 0.5655076900070815,
"deltaVal": 1,
"csiScore": 2.5250357989624175,
"rCsiScore": 14.126967240996628,
"prsScore": 88.6689
},
{
"cell_id": "CL0000576",
"cell_term": "monocyte",
"context": "overall",
"pVal": 0.666853206647587,
"deltaVal": 1,
"csiScore": 2.3969253414015865,
"rCsiScore": 4.33237434422068,
"prsScore": 92.2967
},
{
"cell_id": "CL0000050",
"cell_term": "megakaryocyte-erythroid progenitor cell",
"context": "overall",
"pVal": 0.7192418389933128,
"deltaVal": 1,
"csiScore": 2.295638264446285,
"rCsiScore": 2.073094856574482,
"prsScore": 89.8996
},
{
"cell_id": "CL0000782",
"cell_term": "myeloid dendritic cell",
"context": "overall",
"pVal": 0.7036398034241771,
"deltaVal": 1,
"csiScore": 1.919428062285205,
"rCsiScore": 2.7806803597507908,
"prsScore": 97.4222
},
{
"cell_id": "CL0000113",
"cell_term": "mononuclear phagocyte",
"context": "overall",
"pVal": 0.7268085573859593,
"deltaVal": 1,
"csiScore": 1.9121189929038613,
"rCsiScore": 4.209258835118553,
"prsScore": 93.3995
},
{
"cell_id": "CL3000001",
"cell_term": "Hofbauer cell",
"context": "overall",
"pVal": 0.7106369064889551,
"deltaVal": 1,
"csiScore": 1.8795919260913352,
"rCsiScore": 3.548308172482427,
"prsScore": 95.167
},
{
"cell_id": "CL0001056",
"cell_term": "dendritic cell, human",
"context": "overall",
"pVal": 0.7128398441166097,
"deltaVal": 1,
"csiScore": 1.876263916975933,
"rCsiScore": 2.8816427445607844,
"prsScore": 95.8381
},
{
"cell_id": "CL0000771",
"cell_term": "eosinophil",
"context": "overall",
"pVal": 0.552662745979569,
"deltaVal": 1,
"csiScore": 1.868060059670515,
"rCsiScore": 12.258306839123755,
"prsScore": 96.9683
},
{
"cell_id": "CL1001603",
"cell_term": "lung macrophage",
"context": "overall",
"pVal": 0.6464132716552191,
"deltaVal": 1,
"csiScore": 1.8475389494002483,
"rCsiScore": 4.1264472373848085,
"prsScore": 95.0707
},
{
"cell_id": "CL0002393",
"cell_term": "intermediate monocyte",
"context": "overall",
"pVal": 0.7335318970234022,
"deltaVal": 1,
"csiScore": 1.4242821398784697,
"rCsiScore": 2.1490182542507554,
"prsScore": 94.7582
},
{
"cell_id": "CL0000583",
"cell_term": "alveolar macrophage",
"context": "overall",
"pVal": 0.7551184600778189,
"deltaVal": 1,
"csiScore": 1.1832135147446181,
"rCsiScore": 1.9488848323366652,
"prsScore": 92.8585
},
{
"cell_id": "CL0002057",
"cell_term": "CD14-positive, CD16-negative classical monocyte",
"context": "overall",
"pVal": 0.639053304907313,
"deltaVal": 1,
"csiScore": 1.0973945263947846,
"rCsiScore": 6.639342866709925,
"prsScore": 95.7857
}
]
}
}