Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Raw Database JSON for Gene ID: 5008

{
    "geneID": 5008,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "CP068256.2"
        ]
    },
    "genePos": {
        "start": 30262829,
        "end": 30266851
    },
    "orientation": false,
    "symbol": "OSM",
    "created": {
        "$date": {
            "$numberLong": "1738333349053"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000099985",
        "enseRnaID": [
            "ENST00000403389.1"
        ],
        "enseProtID": [
            "ENSP00000383893.1"
        ]
    },
    "chrom": {
        "pos": "22",
        "type": 1,
        "loc": "22q12.2"
    },
    "desc": "oncostatin M",
    "geneType": 5,
    "mim": [
        {
            "id": 165095,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-168256",
            "term": "Immune System",
            "cat": 10
        },
        {
            "id": "R-HSA-1280215",
            "term": "Cytokine Signaling in Immune system",
            "cat": 11
        },
        {
            "id": "R-HSA-449147",
            "term": "Signaling by Interleukins",
            "cat": 12
        },
        {
            "id": "R-HSA-6783589",
            "term": "Interleukin-6 family signaling",
            "cat": 13
        },
        {
            "id": "R-HSA-6785807",
            "term": "Interleukin-4 and Interleukin-13 signaling",
            "cat": 13
        },
        {
            "id": "R-HSA-6788467",
            "term": "IL-6-type cytokine receptor ligand interactions",
            "cat": 14
        },
        {
            "id": "GO:0005125",
            "term": "cytokine activity",
            "cat": 0
        },
        {
            "id": "GO:0005125",
            "term": "cytokine activity",
            "pubMed": [
                8999038
            ],
            "cat": 0
        },
        {
            "id": "GO:0005147",
            "term": "oncostatin-M receptor binding",
            "pubMed": [
                8999038
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                16051226,
                28514442,
                33961781
            ],
            "cat": 0
        },
        {
            "id": "GO:0008083",
            "term": "growth factor activity",
            "pubMed": [
                8999038
            ],
            "cat": 0
        },
        {
            "id": "GO:0002675",
            "term": "positive regulation of acute inflammatory response",
            "pubMed": [
                8999038
            ],
            "cat": 1
        },
        {
            "id": "GO:0006955",
            "term": "immune response",
            "cat": 1
        },
        {
            "id": "GO:0008284",
            "term": "positive regulation of cell population proliferation",
            "pubMed": [
                8999038
            ],
            "cat": 1
        },
        {
            "id": "GO:0008285",
            "term": "negative regulation of cell population proliferation",
            "pubMed": [
                1717982
            ],
            "cat": 1
        },
        {
            "id": "GO:0032740",
            "term": "positive regulation of interleukin-17 production",
            "pubMed": [
                28972028
            ],
            "cat": 1
        },
        {
            "id": "GO:0033138",
            "term": "positive regulation of peptidyl-serine phosphorylation",
            "pubMed": [
                7508917
            ],
            "cat": 1
        },
        {
            "id": "GO:0038165",
            "term": "oncostatin-M-mediated signaling pathway",
            "pubMed": [
                8999038,
                28972028
            ],
            "cat": 1
        },
        {
            "id": "GO:0042531",
            "term": "positive regulation of tyrosine phosphorylation of STAT protein",
            "pubMed": [
                21912637
            ],
            "cat": 1
        },
        {
            "id": "GO:0043410",
            "term": "positive regulation of MAPK cascade",
            "pubMed": [
                7508917
            ],
            "cat": 1
        },
        {
            "id": "GO:0045944",
            "term": "positive regulation of transcription by RNA polymerase II",
            "pubMed": [
                7508917
            ],
            "cat": 1
        },
        {
            "id": "GO:0046888",
            "term": "negative regulation of hormone secretion",
            "pubMed": [
                7867561
            ],
            "cat": 1
        },
        {
            "id": "GO:0050729",
            "term": "positive regulation of inflammatory response",
            "pubMed": [
                28972028
            ],
            "cat": 1
        },
        {
            "id": "GO:0050731",
            "term": "positive regulation of peptidyl-tyrosine phosphorylation",
            "pubMed": [
                7508917
            ],
            "cat": 1
        },
        {
            "id": "GO:0050731",
            "term": "positive regulation of peptidyl-tyrosine phosphorylation",
            "pubMed": [
                8999038
            ],
            "cat": 1
        },
        {
            "id": "GO:0051781",
            "term": "positive regulation of cell division",
            "cat": 1
        },
        {
            "id": "GO:0051897",
            "term": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction",
            "pubMed": [
                28972028
            ],
            "cat": 1
        },
        {
            "id": "GO:1902036",
            "term": "regulation of hematopoietic stem cell differentiation",
            "pubMed": [
                1542793
            ],
            "cat": 1
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "cat": 2
        },
        {
            "id": "GO:0005615",
            "term": "extracellular space",
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "ONCM_HUMAN",
            "name": "Oncostatin-M",
            "accession": [
                "P13725",
                "Q6FHP8",
                "Q9UCP6"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "M27288",
                    "M27286",
                    "M27287",
                    "CR456534",
                    "CR541703",
                    "AC004264",
                    "CH471095",
                    "BC011589"
                ],
                "CCDS": [
                    "CCDS13873.1"
                ],
                "PIR": [
                    "A32489"
                ],
                "RefSeq": [
                    "NP_001306037.1",
                    "NP_065391.1"
                ],
                "PDB": [
                    "1EVS"
                ],
                "PDBsum": [
                    "1EVS"
                ],
                "AlphaFoldDB": [
                    "P13725"
                ],
                "BMRB": [
                    "P13725"
                ],
                "SMR": [
                    "P13725"
                ],
                "BioGRID": [
                    "111049"
                ],
                "DIP": [
                    "DIP-5785N"
                ],
                "IntAct": [
                    "P13725"
                ],
                "MINT": [
                    "P13725"
                ],
                "STRING": [
                    "9606.ENSP00000215781"
                ],
                "GlyCosmos": [
                    "P13725"
                ],
                "GlyGen": [
                    "P13725"
                ],
                "iPTMnet": [
                    "P13725"
                ],
                "PhosphoSitePlus": [
                    "P13725"
                ],
                "BioMuta": [
                    "OSM"
                ],
                "DMDM": [
                    "129168"
                ],
                "MassIVE": [
                    "P13725"
                ],
                "PaxDb": [
                    "9606-ENSP00000215781"
                ],
                "PeptideAtlas": [
                    "P13725"
                ],
                "ProteomicsDB": [
                    "52975"
                ],
                "Antibodypedia": [
                    "10652"
                ],
                "DNASU": [
                    "5008"
                ],
                "Ensembl": [
                    "ENST00000215781.3"
                ],
                "KEGG": [
                    "hsa:5008"
                ],
                "MANE-Select": [
                    "ENST00000215781.3"
                ],
                "UCSC": [
                    "uc003ahb.4"
                ],
                "AGR": [
                    "HGNC:8506"
                ],
                "CTD": [
                    "5008"
                ],
                "DisGeNET": [
                    "5008"
                ],
                "GeneCards": [
                    "OSM"
                ],
                "HGNC": [
                    "HGNC:8506"
                ],
                "HPA": [
                    "ENSG00000099985"
                ],
                "MIM": [
                    "165095"
                ],
                "neXtProt": [
                    "NX_P13725"
                ],
                "OpenTargets": [
                    "ENSG00000099985"
                ],
                "PharmGKB": [
                    "PA32836"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000099985"
                ],
                "eggNOG": [
                    "ENOG502RVJA"
                ],
                "GeneTree": [
                    "ENSGT00390000004850"
                ],
                "HOGENOM": [
                    "CLU_102028_0_0_1"
                ],
                "InParanoid": [
                    "P13725"
                ],
                "OMA": [
                    "FMHSVGQ"
                ],
                "OrthoDB": [
                    "4641001at2759"
                ],
                "PhylomeDB": [
                    "P13725"
                ],
                "TreeFam": [
                    "TF338204"
                ],
                "PathwayCommons": [
                    "P13725"
                ],
                "Reactome": [
                    "R-HSA-6785807",
                    "R-HSA-6788467"
                ],
                "SignaLink": [
                    "P13725"
                ],
                "SIGNOR": [
                    "P13725"
                ],
                "BioGRID-ORCS": [
                    "5008"
                ],
                "EvolutionaryTrace": [
                    "P13725"
                ],
                "GeneWiki": [
                    "Oncostatin_M"
                ],
                "GenomeRNAi": [
                    "5008"
                ],
                "Pharos": [
                    "P13725"
                ],
                "PRO": [
                    "PR:P13725"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P13725"
                ],
                "Bgee": [
                    "ENSG00000099985"
                ],
                "ExpressionAtlas": [
                    "P13725"
                ],
                "GO": [
                    "GO:0005576",
                    "GO:0005615",
                    "GO:0005125",
                    "GO:0008083",
                    "GO:0005147",
                    "GO:0006955",
                    "GO:0008285",
                    "GO:0046888",
                    "GO:0038165",
                    "GO:0002675",
                    "GO:0051781",
                    "GO:0008284",
                    "GO:0050729",
                    "GO:0032740",
                    "GO:0043410",
                    "GO:0033138",
                    "GO:0050731",
                    "GO:0051897",
                    "GO:0045944",
                    "GO:0042531",
                    "GO:1902036"
                ],
                "Gene3D": [
                    "1.20.1250.10"
                ],
                "InterPro": [
                    "IPR009079",
                    "IPR001581",
                    "IPR019827",
                    "IPR039578"
                ],
                "PANTHER": [
                    "PTHR14261",
                    "PTHR14261:SF0"
                ],
                "Pfam": [
                    "PF01291"
                ],
                "SMART": [
                    "SM00080"
                ],
                "SUPFAM": [
                    "SSF47266"
                ],
                "PROSITE": [
                    "PS00590"
                ]
            },
            "citations": [
                {
                    "title": "Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M.",
                    "pubmedID": "2779549",
                    "doi": "10.1128/mcb.9.7.2847-2853.1989"
                },
                {
                    "title": "A genome annotation-driven approach to cloning the human ORFeome.",
                    "pubmedID": "15461802",
                    "doi": "10.1186/gb-2004-5-10-r84"
                },
                {
                    "title": "The DNA sequence of human chromosome 22.",
                    "pubmedID": "10591208",
                    "doi": "10.1038/990031"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Oncostatin M: a growth regulator produced by differentiated histiocytic lymphoma cells.",
                    "pubmedID": "3540948",
                    "doi": "10.1073/pnas.83.24.9739"
                },
                {
                    "title": "Identification of a major growth factor for AIDS-Kaposi's sarcoma cells as oncostatin M.",
                    "pubmedID": "1542792",
                    "doi": "10.1126/science.1542792"
                },
                {
                    "title": "Cleavage of a hydrophilic C-terminal domain increases growth-inhibitory activity of oncostatin M.",
                    "pubmedID": "2325640",
                    "doi": "10.1128/mcb.10.5.1882-1890.1990"
                },
                {
                    "title": "Disulfide bond assignment and identification of regions required for functional activity of oncostatin M.",
                    "pubmedID": "2026606",
                    "doi": "10.1016/s0021-9258(18)31534-5"
                },
                {
                    "title": "Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6.",
                    "pubmedID": "1717982",
                    "doi": "10.1073/pnas.88.19.8641"
                },
                {
                    "title": "Oncostatin M as a potent mitogen for AIDS-Kaposi's sarcoma-derived cells.",
                    "pubmedID": "1542793",
                    "doi": "10.1126/science.1542793"
                },
                {
                    "title": "Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.",
                    "pubmedID": "8999038",
                    "doi": "10.1074/jbc.271.51.32635"
                },
                {
                    "title": "Crystal structure and functional dissection of the cytostatic cytokine oncostatin M.",
                    "pubmedID": "10997905",
                    "doi": "10.1016/s0969-2126(00)00176-3"
                }
            ],
            "sequence": {
                "length": 252,
                "mass": 28484,
                "checksum": "A5BE281175D101B9",
                "modified": {
                    "$date": {
                        "$numberLong": "649468800000"
                    }
                },
                "version": 2,
                "sequence": "MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 4154560572
        },
        {
            "symbol": "B5MCX1_HUMAN",
            "accession": [
                "B5MCX1"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "AC004264"
                ],
                "RefSeq": [
                    "NP_001306037.1"
                ],
                "AlphaFoldDB": [
                    "B5MCX1"
                ],
                "SMR": [
                    "B5MCX1"
                ],
                "MassIVE": [
                    "B5MCX1"
                ],
                "PeptideAtlas": [
                    "B5MCX1",
                    "B5MCX1"
                ],
                "ProteomicsDB": [
                    "6118",
                    "B5MCX1"
                ],
                "Antibodypedia": [
                    "10652"
                ],
                "DNASU": [
                    "5008"
                ],
                "Ensembl": [
                    "ENST00000403389.1",
                    "ENSP00000383893.1"
                ],
                "UCSC": [
                    "uc062dan.1"
                ],
                "CTD": [
                    "5008"
                ],
                "DisGeNET": [
                    "5008"
                ],
                "HGNC": [
                    "HGNC:8506"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000099985"
                ],
                "GeneTree": [
                    "ENSGT00390000004850"
                ],
                "OrthoDB": [
                    "4641001at2759"
                ],
                "BioGRID-ORCS": [
                    "5008"
                ],
                "Proteomes": [
                    "UP000005640",
                    "UP000005640"
                ],
                "Bgee": [
                    "ENSG00000099985"
                ],
                "ExpressionAtlas": [
                    "B5MCX1"
                ],
                "GO": [
                    "GO:0005576",
                    "GO:0005125",
                    "GO:0005147",
                    "GO:0006955",
                    "GO:0038165",
                    "GO:0010646",
                    "GO:0023051"
                ],
                "Gene3D": [
                    "1.20.1250.10"
                ],
                "InterPro": [
                    "IPR009079",
                    "IPR001581",
                    "IPR019827",
                    "IPR039578"
                ],
                "PANTHER": [
                    "PTHR14261",
                    "PTHR14261:SF0"
                ],
                "Pfam": [
                    "PF01291"
                ],
                "SMART": [
                    "SM00080"
                ],
                "SUPFAM": [
                    "SSF47266"
                ],
                "PROSITE": [
                    "PS00590"
                ],
                "ARBA": [
                    "ARBA00004613",
                    "ARBA00005971",
                    "ARBA00022525",
                    "ARBA00022729"
                ],
                "SAM": [
                    "MobiDB-lite"
                ]
            },
            "citations": [
                {
                    "title": "The DNA sequence of human chromosome 22.",
                    "pubmedID": "10591208",
                    "doi": "10.1038/990031"
                },
                {
                    "title": "Initial sequencing and analysis of the human genome.",
                    "pubmedID": "11237011",
                    "doi": "10.1038/35057062"
                },
                {
                    "title": "Finishing the euchromatic sequence of the human genome.",
                    "pubmedID": "15496913",
                    "doi": "10.1038/nature03001"
                },
                {
                    "title": "Finishing the finished human chromosome 22 sequence.",
                    "pubmedID": "18477386",
                    "doi": "10.1186/gb-2008-9-5-r78"
                }
            ],
            "sequence": {
                "length": 231,
                "mass": 26216,
                "checksum": "2554E3AFA63FBA08",
                "modified": {
                    "$date": {
                        "$numberLong": "1223942400000"
                    }
                },
                "version": 1,
                "sequence": "MASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR"
            },
            "existence": 0,
            "relevance": 2,
            "proteinID": 3499601832
        }
    ],
    "mRNAExpressions": {
        "proteinAtlas": [
            {
                "l": "Granulocytes",
                "c": "basophil",
                "e": 65.5
            },
            {
                "l": "Granulocytes",
                "c": "neutrophil",
                "e": 35
            }
        ]
    },
    "singleCellExpressions": {
        "cellSignificanceIndex": [
            {
                "cell_id": "CL0000861",
                "cell_term": "elicited macrophage",
                "context": "overall",
                "pVal": 0.4272465302337993,
                "deltaVal": 1,
                "csiScore": 13.63609991941982,
                "rCsiScore": 12.51996103085925,
                "prsScore": 95.1022
            },
            {
                "cell_id": "CL0000129",
                "cell_term": "microglial cell",
                "context": "overall",
                "pVal": 0.3501940285594085,
                "deltaVal": 1,
                "csiScore": 8.943654952655663,
                "rCsiScore": 35.99910522265489,
                "prsScore": 89.7959
            },
            {
                "cell_id": "CL0000766",
                "cell_term": "myeloid leukocyte",
                "context": "overall",
                "pVal": 0.5506732115487685,
                "deltaVal": 1,
                "csiScore": 7.387480567276879,
                "rCsiScore": 6.815768244092118,
                "prsScore": 92.2239
            },
            {
                "cell_id": "CL0000037",
                "cell_term": "hematopoietic stem cell",
                "context": "overall",
                "pVal": 0.6818725676785036,
                "deltaVal": 1,
                "csiScore": 3.5889017027338714,
                "rCsiScore": 2.3854248485662835,
                "prsScore": 92.5335
            },
            {
                "cell_id": "CL0001054",
                "cell_term": "CD14-positive monocyte",
                "context": "overall",
                "pVal": 0.6457684686285381,
                "deltaVal": 1,
                "csiScore": 3.555303070337684,
                "rCsiScore": 4.428102327424326,
                "prsScore": 96.051
            },
            {
                "cell_id": "CL0002397",
                "cell_term": "CD14-positive, CD16-positive monocyte",
                "context": "overall",
                "pVal": 0.6462166916901149,
                "deltaVal": 1,
                "csiScore": 3.3352391369195593,
                "rCsiScore": 4.3701134659556535,
                "prsScore": 96.4112
            },
            {
                "cell_id": "CL0000049",
                "cell_term": "common myeloid progenitor",
                "context": "overall",
                "pVal": 0.7032494033986314,
                "deltaVal": 1,
                "csiScore": 3.055836195864484,
                "rCsiScore": 2.470848938384532,
                "prsScore": 92.1941
            },
            {
                "cell_id": "CL0000094",
                "cell_term": "granulocyte",
                "context": "overall",
                "pVal": 0.6597954486258084,
                "deltaVal": 1,
                "csiScore": 3.0097486895605745,
                "rCsiScore": 4.598415201610097,
                "prsScore": 94.6998
            },
            {
                "cell_id": "CL0000451",
                "cell_term": "dendritic cell",
                "context": "overall",
                "pVal": 0.6734056667746238,
                "deltaVal": 1,
                "csiScore": 2.922944625407166,
                "rCsiScore": 3.6013752059662467,
                "prsScore": 90.7591
            },
            {
                "cell_id": "CL0002399",
                "cell_term": "CD1c-positive myeloid dendritic cell",
                "context": "overall",
                "pVal": 0.6425087777429241,
                "deltaVal": 1,
                "csiScore": 2.721049086803217,
                "rCsiScore": 3.2866494044437387,
                "prsScore": 95.229
            },
            {
                "cell_id": "CL0002396",
                "cell_term": "CD14-low, CD16-positive monocyte",
                "context": "overall",
                "pVal": 0.7161768905723553,
                "deltaVal": 1,
                "csiScore": 2.679232998014129,
                "rCsiScore": 2.064237211952901,
                "prsScore": 93.8992
            },
            {
                "cell_id": "CL0000775",
                "cell_term": "neutrophil",
                "context": "overall",
                "pVal": 0.5655076900070815,
                "deltaVal": 1,
                "csiScore": 2.5250357989624175,
                "rCsiScore": 14.126967240996628,
                "prsScore": 88.6689
            },
            {
                "cell_id": "CL0000576",
                "cell_term": "monocyte",
                "context": "overall",
                "pVal": 0.666853206647587,
                "deltaVal": 1,
                "csiScore": 2.3969253414015865,
                "rCsiScore": 4.33237434422068,
                "prsScore": 92.2967
            },
            {
                "cell_id": "CL0000050",
                "cell_term": "megakaryocyte-erythroid progenitor cell",
                "context": "overall",
                "pVal": 0.7192418389933128,
                "deltaVal": 1,
                "csiScore": 2.295638264446285,
                "rCsiScore": 2.073094856574482,
                "prsScore": 89.8996
            },
            {
                "cell_id": "CL0000782",
                "cell_term": "myeloid dendritic cell",
                "context": "overall",
                "pVal": 0.7036398034241771,
                "deltaVal": 1,
                "csiScore": 1.919428062285205,
                "rCsiScore": 2.7806803597507908,
                "prsScore": 97.4222
            },
            {
                "cell_id": "CL0000113",
                "cell_term": "mononuclear phagocyte",
                "context": "overall",
                "pVal": 0.7268085573859593,
                "deltaVal": 1,
                "csiScore": 1.9121189929038613,
                "rCsiScore": 4.209258835118553,
                "prsScore": 93.3995
            },
            {
                "cell_id": "CL3000001",
                "cell_term": "Hofbauer cell",
                "context": "overall",
                "pVal": 0.7106369064889551,
                "deltaVal": 1,
                "csiScore": 1.8795919260913352,
                "rCsiScore": 3.548308172482427,
                "prsScore": 95.167
            },
            {
                "cell_id": "CL0001056",
                "cell_term": "dendritic cell, human",
                "context": "overall",
                "pVal": 0.7128398441166097,
                "deltaVal": 1,
                "csiScore": 1.876263916975933,
                "rCsiScore": 2.8816427445607844,
                "prsScore": 95.8381
            },
            {
                "cell_id": "CL0000771",
                "cell_term": "eosinophil",
                "context": "overall",
                "pVal": 0.552662745979569,
                "deltaVal": 1,
                "csiScore": 1.868060059670515,
                "rCsiScore": 12.258306839123755,
                "prsScore": 96.9683
            },
            {
                "cell_id": "CL1001603",
                "cell_term": "lung macrophage",
                "context": "overall",
                "pVal": 0.6464132716552191,
                "deltaVal": 1,
                "csiScore": 1.8475389494002483,
                "rCsiScore": 4.1264472373848085,
                "prsScore": 95.0707
            },
            {
                "cell_id": "CL0002393",
                "cell_term": "intermediate monocyte",
                "context": "overall",
                "pVal": 0.7335318970234022,
                "deltaVal": 1,
                "csiScore": 1.4242821398784697,
                "rCsiScore": 2.1490182542507554,
                "prsScore": 94.7582
            },
            {
                "cell_id": "CL0000583",
                "cell_term": "alveolar macrophage",
                "context": "overall",
                "pVal": 0.7551184600778189,
                "deltaVal": 1,
                "csiScore": 1.1832135147446181,
                "rCsiScore": 1.9488848323366652,
                "prsScore": 92.8585
            },
            {
                "cell_id": "CL0002057",
                "cell_term": "CD14-positive, CD16-negative classical monocyte",
                "context": "overall",
                "pVal": 0.639053304907313,
                "deltaVal": 1,
                "csiScore": 1.0973945263947846,
                "rCsiScore": 6.639342866709925,
                "prsScore": 95.7857
            }
        ]
    }
}