Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 5620
{
"geneID": 5620,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC009121.8"
]
},
"genePos": {
"start": 11275639,
"end": 11276480
},
"orientation": true,
"symbol": "PRM2",
"created": {
"$date": {
"$numberLong": "1738333349104"
}
},
"crossReference": {
"enseGeneID": "ENSG00000122304",
"enseRnaID": [
"ENST00000435245.2"
],
"enseProtID": [
"ENSP00000403681.2"
]
},
"chrom": {
"pos": "16",
"type": 1,
"loc": "16p13.13"
},
"desc": "protamine 2",
"geneType": 5,
"mim": [
{
"id": 182890,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-1266738",
"term": "Developmental Biology",
"cat": 10
},
{
"id": "R-HSA-9816359",
"term": "Maternal to zygotic transition (MZT)",
"cat": 11
},
{
"id": "R-HSA-9821993",
"term": "Replacement of protamines by nucleosomes in the male pronucleus",
"cat": 12
},
{
"id": "GO:0003677",
"term": "DNA binding",
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
32296183
],
"cat": 0
},
{
"id": "GO:0008270",
"term": "zinc ion binding",
"pubMed": [
2243113
],
"cat": 0
},
{
"id": "GO:0046870",
"term": "cadmium ion binding",
"pubMed": [
2243113
],
"cat": 0
},
{
"id": "GO:0006997",
"term": "nucleus organization",
"cat": 1
},
{
"id": "GO:0007283",
"term": "spermatogenesis",
"cat": 1
},
{
"id": "GO:0007286",
"term": "spermatid development",
"cat": 1
},
{
"id": "GO:0030261",
"term": "chromosome condensation",
"cat": 1
},
{
"id": "GO:0051238",
"term": "sequestering of metal ion",
"pubMed": [
2243113
],
"cat": 1
},
{
"id": "GO:0051276",
"term": "chromosome organization",
"pubMed": [
2081589
],
"cat": 1
},
{
"id": "GO:0000786",
"term": "nucleosome",
"cat": 2
},
{
"id": "GO:0001673",
"term": "male germ cell nucleus",
"cat": 2
},
{
"id": "GO:0005634",
"term": "nucleus",
"pubMed": [
21630459
],
"cat": 2
},
{
"id": "GO:0005634",
"term": "nucleus",
"cat": 2
},
{
"id": "GO:0005654",
"term": "nucleoplasm",
"pubMed": [
2081589
],
"cat": 2
}
],
"protein": [
{
"symbol": "PRM2_HUMAN",
"name": "Protamine-2",
"accession": [
"P04554",
"Q6ZMM0"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"X07862",
"M60332",
"Z46940",
"U15422",
"AF215713",
"AK131573",
"AC009121",
"BC005303",
"BC066338"
],
"CCDS": [
"CCDS42118.1",
"CCDS66944.1"
],
"PIR": [
"B38515"
],
"RefSeq": [
"NP_001273285.1",
"NP_001273287.1",
"NP_001273288.1",
"NP_002753.2"
],
"AlphaFoldDB": [
"P04554"
],
"BioGRID": [
"111605"
],
"IntAct": [
"P04554"
],
"STRING": [
"9606.ENSP00000403681"
],
"iPTMnet": [
"P04554"
],
"PhosphoSitePlus": [
"P04554"
],
"BioMuta": [
"PRM2"
],
"DMDM": [
"123700"
],
"MassIVE": [
"P04554"
],
"PaxDb": [
"9606-ENSP00000403681"
],
"PeptideAtlas": [
"P04554"
],
"ProteomicsDB": [
"51717",
"67890"
],
"Antibodypedia": [
"58005"
],
"DNASU": [
"5620"
],
"Ensembl": [
"ENST00000241808.9",
"ENST00000435245.2"
],
"KEGG": [
"hsa:5620"
],
"MANE-Select": [
"ENST00000241808.9"
],
"UCSC": [
"uc032drg.2"
],
"AGR": [
"HGNC:9448"
],
"CTD": [
"5620"
],
"DisGeNET": [
"5620"
],
"GeneCards": [
"PRM2"
],
"HGNC": [
"HGNC:9448"
],
"HPA": [
"ENSG00000122304"
],
"MIM": [
"182882",
"182890"
],
"neXtProt": [
"NX_P04554"
],
"OpenTargets": [
"ENSG00000122304"
],
"PharmGKB": [
"PA33793"
],
"VEuPathDB": [
"HostDB:ENSG00000122304"
],
"eggNOG": [
"ENOG502TD5P"
],
"GeneTree": [
"ENSGT00940000163619"
],
"HOGENOM": [
"CLU_175685_0_0_1"
],
"InParanoid": [
"P04554"
],
"OMA": [
"PCAPIPG"
],
"OrthoDB": [
"4706552at2759"
],
"TreeFam": [
"TF338206"
],
"PathwayCommons": [
"P04554"
],
"Reactome": [
"R-HSA-9821993"
],
"SignaLink": [
"P04554"
],
"BioGRID-ORCS": [
"5620"
],
"ChiTaRS": [
"PRM2"
],
"GenomeRNAi": [
"5620"
],
"Pharos": [
"P04554"
],
"PRO": [
"PR:P04554"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P04554"
],
"Bgee": [
"ENSG00000122304"
],
"ExpressionAtlas": [
"P04554"
],
"GO": [
"GO:0001673",
"GO:0005654",
"GO:0000786",
"GO:0005634",
"GO:0046870",
"GO:0003677",
"GO:0008270",
"GO:0030261",
"GO:0051276",
"GO:0006997",
"GO:0051238",
"GO:0007286",
"GO:0007283"
],
"InterPro": [
"IPR000492"
],
"PANTHER": [
"PTHR21341",
"PTHR21341:SF2"
],
"Pfam": [
"PF00841"
]
},
"citations": [
{
"title": "Sequence of human protamine 2 cDNA.",
"pubmedID": "3412906",
"doi": "10.1093/nar/16.15.7733"
},
{
"title": "Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered.",
"pubmedID": "2081589",
"doi": "10.1016/0888-7543(90)90234-l"
},
{
"title": "Characterization of a human locus in transition.",
"pubmedID": "7983046",
"doi": "10.1016/s0021-9258(18)47391-7"
},
{
"title": "Rapid evolution of male reproductive genes in the descent of man.",
"pubmedID": "10659848",
"doi": "10.1038/35002070"
},
{
"title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
"pubmedID": "14702039",
"doi": "10.1038/ng1285"
},
{
"title": "The sequence and analysis of duplication-rich human chromosome 16.",
"pubmedID": "15616553",
"doi": "10.1038/nature03187"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3.",
"pubmedID": "2384091",
"doi": "10.1111/j.1432-1033.1990.tb19142.x"
},
{
"title": "Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2.",
"pubmedID": "8513794",
"doi": "10.1111/j.1432-1033.1993.tb17940.x"
},
{
"title": "Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines.",
"pubmedID": "3403514",
"doi": "10.1016/s0021-9258(18)37919-5"
},
{
"title": "Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2.",
"pubmedID": "3527226",
"doi": "10.1515/bchm3.1986.367.1.515"
},
{
"title": "Human sperm protamines. Amino-acid sequences of two forms of protamine P2.",
"pubmedID": "3956509",
"doi": "10.1111/j.1432-1033.1986.tb09540.x"
},
{
"title": "Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei.",
"pubmedID": "1889406",
"doi": "10.1111/j.1432-1033.1991.tb16196.x"
}
],
"sequence": {
"length": 102,
"mass": 13051,
"checksum": "CBB8D6F2396F2F9C",
"modified": {
"$date": {
"$numberLong": "657417600000"
}
},
"version": 3,
"sequence": "MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH"
},
"existence": 0,
"relevance": 1,
"proteinID": 1932322913
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}