Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 5620

{
    "geneID": 5620,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC009121.8"
        ]
    },
    "genePos": {
        "start": 11275639,
        "end": 11276480
    },
    "orientation": true,
    "symbol": "PRM2",
    "created": {
        "$date": {
            "$numberLong": "1738333349104"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000122304",
        "enseRnaID": [
            "ENST00000435245.2"
        ],
        "enseProtID": [
            "ENSP00000403681.2"
        ]
    },
    "chrom": {
        "pos": "16",
        "type": 1,
        "loc": "16p13.13"
    },
    "desc": "protamine 2",
    "geneType": 5,
    "mim": [
        {
            "id": 182890,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-1266738",
            "term": "Developmental Biology",
            "cat": 10
        },
        {
            "id": "R-HSA-9816359",
            "term": "Maternal to zygotic transition (MZT)",
            "cat": 11
        },
        {
            "id": "R-HSA-9821993",
            "term": "Replacement of protamines by nucleosomes in the male pronucleus",
            "cat": 12
        },
        {
            "id": "GO:0003677",
            "term": "DNA binding",
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                32296183
            ],
            "cat": 0
        },
        {
            "id": "GO:0008270",
            "term": "zinc ion binding",
            "pubMed": [
                2243113
            ],
            "cat": 0
        },
        {
            "id": "GO:0046870",
            "term": "cadmium ion binding",
            "pubMed": [
                2243113
            ],
            "cat": 0
        },
        {
            "id": "GO:0006997",
            "term": "nucleus organization",
            "cat": 1
        },
        {
            "id": "GO:0007283",
            "term": "spermatogenesis",
            "cat": 1
        },
        {
            "id": "GO:0007286",
            "term": "spermatid development",
            "cat": 1
        },
        {
            "id": "GO:0030261",
            "term": "chromosome condensation",
            "cat": 1
        },
        {
            "id": "GO:0051238",
            "term": "sequestering of metal ion",
            "pubMed": [
                2243113
            ],
            "cat": 1
        },
        {
            "id": "GO:0051276",
            "term": "chromosome organization",
            "pubMed": [
                2081589
            ],
            "cat": 1
        },
        {
            "id": "GO:0000786",
            "term": "nucleosome",
            "cat": 2
        },
        {
            "id": "GO:0001673",
            "term": "male germ cell nucleus",
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "pubMed": [
                21630459
            ],
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "cat": 2
        },
        {
            "id": "GO:0005654",
            "term": "nucleoplasm",
            "pubMed": [
                2081589
            ],
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "PRM2_HUMAN",
            "name": "Protamine-2",
            "accession": [
                "P04554",
                "Q6ZMM0"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "X07862",
                    "M60332",
                    "Z46940",
                    "U15422",
                    "AF215713",
                    "AK131573",
                    "AC009121",
                    "BC005303",
                    "BC066338"
                ],
                "CCDS": [
                    "CCDS42118.1",
                    "CCDS66944.1"
                ],
                "PIR": [
                    "B38515"
                ],
                "RefSeq": [
                    "NP_001273285.1",
                    "NP_001273287.1",
                    "NP_001273288.1",
                    "NP_002753.2"
                ],
                "AlphaFoldDB": [
                    "P04554"
                ],
                "BioGRID": [
                    "111605"
                ],
                "IntAct": [
                    "P04554"
                ],
                "STRING": [
                    "9606.ENSP00000403681"
                ],
                "iPTMnet": [
                    "P04554"
                ],
                "PhosphoSitePlus": [
                    "P04554"
                ],
                "BioMuta": [
                    "PRM2"
                ],
                "DMDM": [
                    "123700"
                ],
                "MassIVE": [
                    "P04554"
                ],
                "PaxDb": [
                    "9606-ENSP00000403681"
                ],
                "PeptideAtlas": [
                    "P04554"
                ],
                "ProteomicsDB": [
                    "51717",
                    "67890"
                ],
                "Antibodypedia": [
                    "58005"
                ],
                "DNASU": [
                    "5620"
                ],
                "Ensembl": [
                    "ENST00000241808.9",
                    "ENST00000435245.2"
                ],
                "KEGG": [
                    "hsa:5620"
                ],
                "MANE-Select": [
                    "ENST00000241808.9"
                ],
                "UCSC": [
                    "uc032drg.2"
                ],
                "AGR": [
                    "HGNC:9448"
                ],
                "CTD": [
                    "5620"
                ],
                "DisGeNET": [
                    "5620"
                ],
                "GeneCards": [
                    "PRM2"
                ],
                "HGNC": [
                    "HGNC:9448"
                ],
                "HPA": [
                    "ENSG00000122304"
                ],
                "MIM": [
                    "182882",
                    "182890"
                ],
                "neXtProt": [
                    "NX_P04554"
                ],
                "OpenTargets": [
                    "ENSG00000122304"
                ],
                "PharmGKB": [
                    "PA33793"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000122304"
                ],
                "eggNOG": [
                    "ENOG502TD5P"
                ],
                "GeneTree": [
                    "ENSGT00940000163619"
                ],
                "HOGENOM": [
                    "CLU_175685_0_0_1"
                ],
                "InParanoid": [
                    "P04554"
                ],
                "OMA": [
                    "PCAPIPG"
                ],
                "OrthoDB": [
                    "4706552at2759"
                ],
                "TreeFam": [
                    "TF338206"
                ],
                "PathwayCommons": [
                    "P04554"
                ],
                "Reactome": [
                    "R-HSA-9821993"
                ],
                "SignaLink": [
                    "P04554"
                ],
                "BioGRID-ORCS": [
                    "5620"
                ],
                "ChiTaRS": [
                    "PRM2"
                ],
                "GenomeRNAi": [
                    "5620"
                ],
                "Pharos": [
                    "P04554"
                ],
                "PRO": [
                    "PR:P04554"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P04554"
                ],
                "Bgee": [
                    "ENSG00000122304"
                ],
                "ExpressionAtlas": [
                    "P04554"
                ],
                "GO": [
                    "GO:0001673",
                    "GO:0005654",
                    "GO:0000786",
                    "GO:0005634",
                    "GO:0046870",
                    "GO:0003677",
                    "GO:0008270",
                    "GO:0030261",
                    "GO:0051276",
                    "GO:0006997",
                    "GO:0051238",
                    "GO:0007286",
                    "GO:0007283"
                ],
                "InterPro": [
                    "IPR000492"
                ],
                "PANTHER": [
                    "PTHR21341",
                    "PTHR21341:SF2"
                ],
                "Pfam": [
                    "PF00841"
                ]
            },
            "citations": [
                {
                    "title": "Sequence of human protamine 2 cDNA.",
                    "pubmedID": "3412906",
                    "doi": "10.1093/nar/16.15.7733"
                },
                {
                    "title": "Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered.",
                    "pubmedID": "2081589",
                    "doi": "10.1016/0888-7543(90)90234-l"
                },
                {
                    "title": "Characterization of a human locus in transition.",
                    "pubmedID": "7983046",
                    "doi": "10.1016/s0021-9258(18)47391-7"
                },
                {
                    "title": "Rapid evolution of male reproductive genes in the descent of man.",
                    "pubmedID": "10659848",
                    "doi": "10.1038/35002070"
                },
                {
                    "title": "Complete sequencing and characterization of 21,243 full-length human cDNAs.",
                    "pubmedID": "14702039",
                    "doi": "10.1038/ng1285"
                },
                {
                    "title": "The sequence and analysis of duplication-rich human chromosome 16.",
                    "pubmedID": "15616553",
                    "doi": "10.1038/nature03187"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3.",
                    "pubmedID": "2384091",
                    "doi": "10.1111/j.1432-1033.1990.tb19142.x"
                },
                {
                    "title": "Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2.",
                    "pubmedID": "8513794",
                    "doi": "10.1111/j.1432-1033.1993.tb17940.x"
                },
                {
                    "title": "Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines.",
                    "pubmedID": "3403514",
                    "doi": "10.1016/s0021-9258(18)37919-5"
                },
                {
                    "title": "Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2.",
                    "pubmedID": "3527226",
                    "doi": "10.1515/bchm3.1986.367.1.515"
                },
                {
                    "title": "Human sperm protamines. Amino-acid sequences of two forms of protamine P2.",
                    "pubmedID": "3956509",
                    "doi": "10.1111/j.1432-1033.1986.tb09540.x"
                },
                {
                    "title": "Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei.",
                    "pubmedID": "1889406",
                    "doi": "10.1111/j.1432-1033.1991.tb16196.x"
                }
            ],
            "sequence": {
                "length": 102,
                "mass": 13051,
                "checksum": "CBB8D6F2396F2F9C",
                "modified": {
                    "$date": {
                        "$numberLong": "657417600000"
                    }
                },
                "version": 3,
                "sequence": "MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 1932322913
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}