Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 5988

{
    "geneID": 5988,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC000041.2"
        ]
    },
    "symbol": "RFPL1",
    "created": {
        "$date": {
            "$numberLong": "1738333349136"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000128250",
        "enseRnaID": [
            "ENST00000354373.2"
        ],
        "enseProtID": [
            "ENSP00000346342.2"
        ]
    },
    "genePos": {
        "end": 29442455,
        "start": 29387909
    },
    "chrom": {
        "pos": "22",
        "type": 1,
        "loc": "22q12.2"
    },
    "desc": "ret finger protein like 1",
    "geneType": 5,
    "ontology": [
        {
            "id": "GO:0019901",
            "term": "protein kinase binding",
            "cat": 0
        },
        {
            "id": "GO:0042803",
            "term": "protein homodimerization activity",
            "cat": 0
        },
        {
            "id": "GO:0046872",
            "term": "metal ion binding",
            "cat": 0
        },
        {
            "id": "GO:0061630",
            "term": "ubiquitin protein ligase activity",
            "cat": 0
        },
        {
            "id": "GO:0008285",
            "term": "negative regulation of cell population proliferation",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0010468",
            "term": "regulation of gene expression",
            "cat": 1
        },
        {
            "id": "GO:0010508",
            "term": "positive regulation of autophagy",
            "cat": 1
        },
        {
            "id": "GO:0010972",
            "term": "negative regulation of G2/M transition of mitotic cell cycle",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0032436",
            "term": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0032880",
            "term": "regulation of protein localization",
            "cat": 1
        },
        {
            "id": "GO:0043065",
            "term": "positive regulation of apoptotic process",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0043123",
            "term": "positive regulation of canonical NF-kappaB signal transduction",
            "cat": 1
        },
        {
            "id": "GO:0045087",
            "term": "innate immune response",
            "cat": 1
        },
        {
            "id": "GO:0045930",
            "term": "negative regulation of mitotic cell cycle",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0046596",
            "term": "regulation of viral entry into host cell",
            "cat": 1
        },
        {
            "id": "GO:0051782",
            "term": "negative regulation of cell division",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:2001272",
            "term": "positive regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis",
            "pubMed": [
                20725088
            ],
            "cat": 1
        },
        {
            "id": "GO:0005654",
            "term": "nucleoplasm",
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "pubMed": [
                20725088
            ],
            "cat": 2
        },
        {
            "id": "GO:0005829",
            "term": "cytosol",
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "RFPL1_HUMAN",
            "name": "Ret finger protein-like 1",
            "accession": [
                "O75677",
                "Q6IC06",
                "Q9UJ97"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "AJ010228",
                    "AJ010229",
                    "CR456562",
                    "BC104768"
                ],
                "CCDS": [
                    "CCDS13857.2"
                ],
                "RefSeq": [
                    "NP_066306.2",
                    "XP_011528600.1",
                    "XP_011528601.1",
                    "XP_016884389.1",
                    "XP_016884390.1",
                    "XP_016884391.1"
                ],
                "AlphaFoldDB": [
                    "O75677"
                ],
                "SMR": [
                    "O75677"
                ],
                "BioGRID": [
                    "111920"
                ],
                "IntAct": [
                    "O75677"
                ],
                "STRING": [
                    "9606.ENSP00000346342"
                ],
                "iPTMnet": [
                    "O75677"
                ],
                "PhosphoSitePlus": [
                    "O75677"
                ],
                "BioMuta": [
                    "RFPL1"
                ],
                "jPOST": [
                    "O75677"
                ],
                "MassIVE": [
                    "O75677"
                ],
                "PaxDb": [
                    "9606-ENSP00000346342"
                ],
                "PeptideAtlas": [
                    "O75677"
                ],
                "Antibodypedia": [
                    "24513"
                ],
                "DNASU": [
                    "5988"
                ],
                "Ensembl": [
                    "ENST00000354373.2"
                ],
                "KEGG": [
                    "hsa:5988"
                ],
                "MANE-Select": [
                    "ENST00000354373.2"
                ],
                "UCSC": [
                    "uc003afn.3"
                ],
                "AGR": [
                    "HGNC:9977"
                ],
                "CTD": [
                    "5988"
                ],
                "DisGeNET": [
                    "5988"
                ],
                "GeneCards": [
                    "RFPL1"
                ],
                "HGNC": [
                    "HGNC:9977"
                ],
                "HPA": [
                    "ENSG00000128250"
                ],
                "MIM": [
                    "605968"
                ],
                "neXtProt": [
                    "NX_O75677"
                ],
                "OpenTargets": [
                    "ENSG00000128250"
                ],
                "PharmGKB": [
                    "PA34346"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000128250"
                ],
                "eggNOG": [
                    "KOG2177"
                ],
                "GeneTree": [
                    "ENSGT00940000163408"
                ],
                "HOGENOM": [
                    "CLU_013137_7_1_1"
                ],
                "InParanoid": [
                    "O75677"
                ],
                "OMA": [
                    "CKTSISK"
                ],
                "OrthoDB": [
                    "4508030at2759"
                ],
                "PhylomeDB": [
                    "O75677"
                ],
                "TreeFam": [
                    "TF317532"
                ],
                "PathwayCommons": [
                    "O75677"
                ],
                "SignaLink": [
                    "O75677"
                ],
                "SIGNOR": [
                    "O75677"
                ],
                "BioGRID-ORCS": [
                    "5988"
                ],
                "ChiTaRS": [
                    "RFPL1"
                ],
                "GenomeRNAi": [
                    "5988"
                ],
                "Pharos": [
                    "O75677"
                ],
                "PRO": [
                    "PR:O75677"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "O75677"
                ],
                "Bgee": [
                    "ENSG00000128250"
                ],
                "GO": [
                    "GO:0005737",
                    "GO:0005829",
                    "GO:0005654",
                    "GO:0046872",
                    "GO:0042803",
                    "GO:0019901",
                    "GO:0061630",
                    "GO:0045087",
                    "GO:0051782",
                    "GO:0008285",
                    "GO:0010972",
                    "GO:0045930",
                    "GO:0043065",
                    "GO:0010508",
                    "GO:0043123",
                    "GO:2001272",
                    "GO:0032436",
                    "GO:0000209",
                    "GO:0032880",
                    "GO:0046596"
                ],
                "CDD": [
                    "cd15821",
                    "cd16621"
                ],
                "Gene3D": [
                    "2.60.120.920",
                    "3.30.40.10"
                ],
                "InterPro": [
                    "IPR001870",
                    "IPR043136",
                    "IPR003879",
                    "IPR013320",
                    "IPR006574",
                    "IPR022723",
                    "IPR037960",
                    "IPR003877",
                    "IPR050143",
                    "IPR001841",
                    "IPR013083"
                ],
                "PANTHER": [
                    "PTHR24103",
                    "PTHR24103:SF259"
                ],
                "Pfam": [
                    "PF13765",
                    "PF11002",
                    "PF00622",
                    "PF15227"
                ],
                "PRINTS": [
                    "PR01407"
                ],
                "SMART": [
                    "SM00589",
                    "SM00449"
                ],
                "SUPFAM": [
                    "SSF49899",
                    "SSF57850"
                ],
                "PROSITE": [
                    "PS50188",
                    "PS50089"
                ]
            },
            "citations": [
                {
                    "title": "Duplications on human chromosome 22 reveal a novel Ret finger protein-like gene family with sense and endogenous antisense transcripts.",
                    "pubmedID": "10508838",
                    "doi": "10.1101/gr.9.9.803"
                },
                {
                    "title": "A genome annotation-driven approach to cloning the human ORFeome.",
                    "pubmedID": "15461802",
                    "doi": "10.1186/gb-2004-5-10-r84"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Primate-specific RFPL1 gene controls cell-cycle progression through cyclin B1/Cdc2 degradation.",
                    "pubmedID": "20725088",
                    "doi": "10.1038/cdd.2010.102"
                }
            ],
            "sequence": {
                "length": 317,
                "mass": 35491,
                "checksum": "75FDDED7BF51B8CA",
                "modified": {
                    "$date": {
                        "$numberLong": "1110844800000"
                    }
                },
                "version": 2,
                "sequence": "MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 2165872911
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}