Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 5988
{
"geneID": 5988,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC000041.2"
]
},
"symbol": "RFPL1",
"created": {
"$date": {
"$numberLong": "1738333349136"
}
},
"crossReference": {
"enseGeneID": "ENSG00000128250",
"enseRnaID": [
"ENST00000354373.2"
],
"enseProtID": [
"ENSP00000346342.2"
]
},
"genePos": {
"end": 29442455,
"start": 29387909
},
"chrom": {
"pos": "22",
"type": 1,
"loc": "22q12.2"
},
"desc": "ret finger protein like 1",
"geneType": 5,
"ontology": [
{
"id": "GO:0019901",
"term": "protein kinase binding",
"cat": 0
},
{
"id": "GO:0042803",
"term": "protein homodimerization activity",
"cat": 0
},
{
"id": "GO:0046872",
"term": "metal ion binding",
"cat": 0
},
{
"id": "GO:0061630",
"term": "ubiquitin protein ligase activity",
"cat": 0
},
{
"id": "GO:0008285",
"term": "negative regulation of cell population proliferation",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0010468",
"term": "regulation of gene expression",
"cat": 1
},
{
"id": "GO:0010508",
"term": "positive regulation of autophagy",
"cat": 1
},
{
"id": "GO:0010972",
"term": "negative regulation of G2/M transition of mitotic cell cycle",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0032436",
"term": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0032880",
"term": "regulation of protein localization",
"cat": 1
},
{
"id": "GO:0043065",
"term": "positive regulation of apoptotic process",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0043123",
"term": "positive regulation of canonical NF-kappaB signal transduction",
"cat": 1
},
{
"id": "GO:0045087",
"term": "innate immune response",
"cat": 1
},
{
"id": "GO:0045930",
"term": "negative regulation of mitotic cell cycle",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0046596",
"term": "regulation of viral entry into host cell",
"cat": 1
},
{
"id": "GO:0051782",
"term": "negative regulation of cell division",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:2001272",
"term": "positive regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis",
"pubMed": [
20725088
],
"cat": 1
},
{
"id": "GO:0005654",
"term": "nucleoplasm",
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"pubMed": [
20725088
],
"cat": 2
},
{
"id": "GO:0005829",
"term": "cytosol",
"cat": 2
}
],
"protein": [
{
"symbol": "RFPL1_HUMAN",
"name": "Ret finger protein-like 1",
"accession": [
"O75677",
"Q6IC06",
"Q9UJ97"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"AJ010228",
"AJ010229",
"CR456562",
"BC104768"
],
"CCDS": [
"CCDS13857.2"
],
"RefSeq": [
"NP_066306.2",
"XP_011528600.1",
"XP_011528601.1",
"XP_016884389.1",
"XP_016884390.1",
"XP_016884391.1"
],
"AlphaFoldDB": [
"O75677"
],
"SMR": [
"O75677"
],
"BioGRID": [
"111920"
],
"IntAct": [
"O75677"
],
"STRING": [
"9606.ENSP00000346342"
],
"iPTMnet": [
"O75677"
],
"PhosphoSitePlus": [
"O75677"
],
"BioMuta": [
"RFPL1"
],
"jPOST": [
"O75677"
],
"MassIVE": [
"O75677"
],
"PaxDb": [
"9606-ENSP00000346342"
],
"PeptideAtlas": [
"O75677"
],
"Antibodypedia": [
"24513"
],
"DNASU": [
"5988"
],
"Ensembl": [
"ENST00000354373.2"
],
"KEGG": [
"hsa:5988"
],
"MANE-Select": [
"ENST00000354373.2"
],
"UCSC": [
"uc003afn.3"
],
"AGR": [
"HGNC:9977"
],
"CTD": [
"5988"
],
"DisGeNET": [
"5988"
],
"GeneCards": [
"RFPL1"
],
"HGNC": [
"HGNC:9977"
],
"HPA": [
"ENSG00000128250"
],
"MIM": [
"605968"
],
"neXtProt": [
"NX_O75677"
],
"OpenTargets": [
"ENSG00000128250"
],
"PharmGKB": [
"PA34346"
],
"VEuPathDB": [
"HostDB:ENSG00000128250"
],
"eggNOG": [
"KOG2177"
],
"GeneTree": [
"ENSGT00940000163408"
],
"HOGENOM": [
"CLU_013137_7_1_1"
],
"InParanoid": [
"O75677"
],
"OMA": [
"CKTSISK"
],
"OrthoDB": [
"4508030at2759"
],
"PhylomeDB": [
"O75677"
],
"TreeFam": [
"TF317532"
],
"PathwayCommons": [
"O75677"
],
"SignaLink": [
"O75677"
],
"SIGNOR": [
"O75677"
],
"BioGRID-ORCS": [
"5988"
],
"ChiTaRS": [
"RFPL1"
],
"GenomeRNAi": [
"5988"
],
"Pharos": [
"O75677"
],
"PRO": [
"PR:O75677"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"O75677"
],
"Bgee": [
"ENSG00000128250"
],
"GO": [
"GO:0005737",
"GO:0005829",
"GO:0005654",
"GO:0046872",
"GO:0042803",
"GO:0019901",
"GO:0061630",
"GO:0045087",
"GO:0051782",
"GO:0008285",
"GO:0010972",
"GO:0045930",
"GO:0043065",
"GO:0010508",
"GO:0043123",
"GO:2001272",
"GO:0032436",
"GO:0000209",
"GO:0032880",
"GO:0046596"
],
"CDD": [
"cd15821",
"cd16621"
],
"Gene3D": [
"2.60.120.920",
"3.30.40.10"
],
"InterPro": [
"IPR001870",
"IPR043136",
"IPR003879",
"IPR013320",
"IPR006574",
"IPR022723",
"IPR037960",
"IPR003877",
"IPR050143",
"IPR001841",
"IPR013083"
],
"PANTHER": [
"PTHR24103",
"PTHR24103:SF259"
],
"Pfam": [
"PF13765",
"PF11002",
"PF00622",
"PF15227"
],
"PRINTS": [
"PR01407"
],
"SMART": [
"SM00589",
"SM00449"
],
"SUPFAM": [
"SSF49899",
"SSF57850"
],
"PROSITE": [
"PS50188",
"PS50089"
]
},
"citations": [
{
"title": "Duplications on human chromosome 22 reveal a novel Ret finger protein-like gene family with sense and endogenous antisense transcripts.",
"pubmedID": "10508838",
"doi": "10.1101/gr.9.9.803"
},
{
"title": "A genome annotation-driven approach to cloning the human ORFeome.",
"pubmedID": "15461802",
"doi": "10.1186/gb-2004-5-10-r84"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Primate-specific RFPL1 gene controls cell-cycle progression through cyclin B1/Cdc2 degradation.",
"pubmedID": "20725088",
"doi": "10.1038/cdd.2010.102"
}
],
"sequence": {
"length": 317,
"mass": 35491,
"checksum": "75FDDED7BF51B8CA",
"modified": {
"$date": {
"$numberLong": "1110844800000"
}
},
"version": 2,
"sequence": "MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK"
},
"existence": 0,
"relevance": 1,
"proteinID": 2165872911
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}