Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 6736

{
    "geneID": 6736,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC006040.3"
        ]
    },
    "genePos": {
        "start": 5070,
        "end": 5897
    },
    "orientation": false,
    "symbol": "SRY",
    "created": {
        "$date": {
            "$numberLong": "1738333349190"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000184895",
        "enseRnaID": [
            "ENST00000383070.2"
        ],
        "enseProtID": [
            "ENSP00000372547.1"
        ]
    },
    "chrom": {
        "loc": "Yp11.2"
    },
    "desc": "sex determining region Y",
    "geneType": 5,
    "mim": [
        {
            "id": 400044,
            "relation": 1,
            "cui": 2748896
        },
        {
            "id": 400045,
            "relation": 1,
            "cui": 2748895
        },
        {
            "id": 480000,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-1266738",
            "term": "Developmental Biology",
            "cat": 10
        },
        {
            "id": "R-HSA-162582",
            "term": "Signal Transduction",
            "cat": 10
        },
        {
            "id": "R-HSA-195721",
            "term": "Signaling by WNT",
            "cat": 11
        },
        {
            "id": "R-HSA-9690406",
            "term": "Transcriptional regulation of testis differentiation",
            "cat": 11
        },
        {
            "id": "R-HSA-201681",
            "term": "TCF dependent signaling in response to WNT",
            "cat": 12
        },
        {
            "id": "R-HSA-3769402",
            "term": "Deactivation of the beta-catenin transactivating complex",
            "cat": 13
        },
        {
            "id": "GO:0000978",
            "term": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
            "cat": 0
        },
        {
            "id": "GO:0000981",
            "term": "DNA-binding transcription factor activity, RNA polymerase II-specific",
            "pubMed": [
                21412441
            ],
            "cat": 0
        },
        {
            "id": "GO:0000981",
            "term": "DNA-binding transcription factor activity, RNA polymerase II-specific",
            "cat": 0
        },
        {
            "id": "GO:0001228",
            "term": "DNA-binding transcription activator activity, RNA polymerase II-specific",
            "cat": 0
        },
        {
            "id": "GO:0003677",
            "term": "DNA binding",
            "pubMed": [
                1425584,
                8265659
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                9054412,
                16166090
            ],
            "cat": 0
        },
        {
            "id": "GO:0005516",
            "term": "calmodulin binding",
            "cat": 0
        },
        {
            "id": "GO:0140297",
            "term": "DNA-binding transcription factor binding",
            "pubMed": [
                16582099
            ],
            "cat": 0
        },
        {
            "id": "GO:0000122",
            "term": "negative regulation of transcription by RNA polymerase II",
            "cat": 1
        },
        {
            "id": "GO:0007420",
            "term": "brain development",
            "cat": 1
        },
        {
            "id": "GO:0007548",
            "term": "sex differentiation",
            "cat": 1
        },
        {
            "id": "GO:0010628",
            "term": "positive regulation of gene expression",
            "pubMed": [
                24681825
            ],
            "cat": 1
        },
        {
            "id": "GO:0030182",
            "term": "neuron differentiation",
            "cat": 1
        },
        {
            "id": "GO:0030238",
            "term": "male sex determination",
            "pubMed": [
                1695712
            ],
            "cat": 1
        },
        {
            "id": "GO:0045893",
            "term": "positive regulation of DNA-templated transcription",
            "pubMed": [
                21412441
            ],
            "cat": 1
        },
        {
            "id": "GO:0045944",
            "term": "positive regulation of transcription by RNA polymerase II",
            "cat": 1
        },
        {
            "id": "GO:2000020",
            "term": "positive regulation of male gonad development",
            "pubMed": [
                21412441
            ],
            "cat": 1
        },
        {
            "id": "GO:0000785",
            "term": "chromatin",
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "pubMed": [
                21412441,
                28030592
            ],
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "pubMed": [
                1425584,
                8265659
            ],
            "cat": 2
        },
        {
            "id": "GO:0005654",
            "term": "nucleoplasm",
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "cat": 2
        },
        {
            "id": "GO:0016607",
            "term": "nuclear speck",
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "SRY_HUMAN",
            "accession": [
                "Q05066"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "MIM": [
                    "400044",
                    "400045",
                    "400044",
                    "400045",
                    "480000"
                ],
                "EMBL": [
                    "X53772",
                    "L10101",
                    "L10102",
                    "L08063",
                    "X96421",
                    "S53156",
                    "S56543",
                    "BC074923",
                    "BC074924"
                ],
                "CCDS": [
                    "CCDS14772.1"
                ],
                "PIR": [
                    "A47533"
                ],
                "RefSeq": [
                    "NP_003131.1"
                ],
                "PDB": [
                    "1HRY",
                    "1HRZ",
                    "1J46",
                    "1J47",
                    "2GZK",
                    "6EDB",
                    "7YHO",
                    "7YHP",
                    "7YHQ"
                ],
                "PDBsum": [
                    "1HRY",
                    "1HRZ",
                    "1J46",
                    "1J47",
                    "2GZK",
                    "6EDB",
                    "7YHO",
                    "7YHP",
                    "7YHQ"
                ],
                "AlphaFoldDB": [
                    "Q05066"
                ],
                "EMDB": [
                    "EMD-33832",
                    "EMD-33836"
                ],
                "SMR": [
                    "Q05066"
                ],
                "BioGRID": [
                    "112614"
                ],
                "IntAct": [
                    "Q05066"
                ],
                "MINT": [
                    "Q05066"
                ],
                "STRING": [
                    "9606.ENSP00000372547"
                ],
                "iPTMnet": [
                    "Q05066"
                ],
                "PhosphoSitePlus": [
                    "Q05066"
                ],
                "BioMuta": [
                    "SRY"
                ],
                "DMDM": [
                    "548983"
                ],
                "MassIVE": [
                    "Q05066"
                ],
                "PeptideAtlas": [
                    "Q05066"
                ],
                "ABCD": [
                    "Q05066"
                ],
                "Antibodypedia": [
                    "599"
                ],
                "DNASU": [
                    "6736"
                ],
                "Ensembl": [
                    "ENST00000383070.2"
                ],
                "KEGG": [
                    "hsa:6736"
                ],
                "MANE-Select": [
                    "ENST00000383070.2"
                ],
                "UCSC": [
                    "uc004fqg.3"
                ],
                "AGR": [
                    "HGNC:11311"
                ],
                "CTD": [
                    "6736"
                ],
                "DisGeNET": [
                    "6736"
                ],
                "GeneCards": [
                    "SRY"
                ],
                "GeneReviews": [
                    "SRY"
                ],
                "HGNC": [
                    "HGNC:11311"
                ],
                "HPA": [
                    "ENSG00000184895"
                ],
                "MalaCards": [
                    "SRY"
                ],
                "neXtProt": [
                    "NX_Q05066"
                ],
                "OpenTargets": [
                    "ENSG00000184895"
                ],
                "Orphanet": [
                    "1772",
                    "2138",
                    "393",
                    "242",
                    "251510"
                ],
                "PharmGKB": [
                    "PA36135"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000184895"
                ],
                "GeneTree": [
                    "ENSGT00940000165583"
                ],
                "HOGENOM": [
                    "CLU_1209425_0_0_1"
                ],
                "InParanoid": [
                    "Q05066"
                ],
                "OMA": [
                    "DCTKATH"
                ],
                "OrthoDB": [
                    "2902801at2759"
                ],
                "PhylomeDB": [
                    "Q05066"
                ],
                "PathwayCommons": [
                    "Q05066"
                ],
                "Reactome": [
                    "R-HSA-3769402",
                    "R-HSA-9690406"
                ],
                "SignaLink": [
                    "Q05066"
                ],
                "SIGNOR": [
                    "Q05066"
                ],
                "BioGRID-ORCS": [
                    "6736"
                ],
                "EvolutionaryTrace": [
                    "Q05066"
                ],
                "GeneWiki": [
                    "SRY"
                ],
                "GenomeRNAi": [
                    "6736"
                ],
                "Pharos": [
                    "Q05066"
                ],
                "PRO": [
                    "PR:Q05066"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "Q05066"
                ],
                "Bgee": [
                    "ENSG00000184895"
                ],
                "ExpressionAtlas": [
                    "Q05066"
                ],
                "GO": [
                    "GO:0000785",
                    "GO:0005737",
                    "GO:0016607",
                    "GO:0005654",
                    "GO:0005634",
                    "GO:0005516",
                    "GO:0003677",
                    "GO:0001228",
                    "GO:0000981",
                    "GO:0140297",
                    "GO:0000978",
                    "GO:0007420",
                    "GO:0030238",
                    "GO:0000122",
                    "GO:0030182",
                    "GO:0045893",
                    "GO:0010628",
                    "GO:2000020",
                    "GO:0045944",
                    "GO:0007548"
                ],
                "CDD": [
                    "cd22034"
                ],
                "Gene3D": [
                    "1.10.30.10"
                ],
                "IDEAL": [
                    "IID00315"
                ],
                "InterPro": [
                    "IPR009071",
                    "IPR036910",
                    "IPR017253",
                    "IPR050140"
                ],
                "PANTHER": [
                    "PTHR10270:SF199",
                    "PTHR10270"
                ],
                "Pfam": [
                    "PF00505"
                ],
                "PIRSF": [
                    "PIRSF037653"
                ],
                "SMART": [
                    "SM00398"
                ],
                "SUPFAM": [
                    "SSF47095"
                ],
                "PROSITE": [
                    "PS50118"
                ]
            },
            "citations": [
                {
                    "title": "A gene from the human sex-determining region encodes a protein with homology to a conserved DNA-binding motif.",
                    "pubmedID": "1695712",
                    "doi": "10.1038/346240a0"
                },
                {
                    "title": "Identification of the transcriptional unit, structural organization, and promoter sequence of the human sex-determining region Y (SRY) gene, using a reverse genetic approach.",
                    "pubmedID": "8434602"
                },
                {
                    "title": "Evidence that the SRY protein is encoded by a single exon on the human Y chromosome.",
                    "pubmedID": "8244390",
                    "doi": "10.1006/geno.1993.1395"
                },
                {
                    "title": "41 kilobases of analyzed sequence from the pseudoautosomal and sex-determining regions of the short arm of the human Y chromosome.",
                    "pubmedID": "7557997",
                    "doi": "10.1006/geno.1995.1047"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "SRY, like HMG1, recognizes sharp angles in DNA.",
                    "pubmedID": "1425584",
                    "doi": "10.1002/j.1460-2075.1992.tb05551.x"
                },
                {
                    "title": "The SRY high-mobility-group box recognizes DNA by partial intercalation in the minor groove: a topological mechanism of sequence specificity.",
                    "pubmedID": "8265659",
                    "doi": "10.1073/pnas.90.24.11990"
                },
                {
                    "title": "Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors.",
                    "pubmedID": "8159753",
                    "doi": "10.1073/pnas.91.8.3368"
                },
                {
                    "title": "The human testis determining factor SRY binds a nuclear factor containing PDZ protein interaction domains.",
                    "pubmedID": "9054412",
                    "doi": "10.1074/jbc.272.11.7167"
                },
                {
                    "title": "Phosphorylation of an N-terminal motif enhances DNA-binding activity of the human SRY protein.",
                    "pubmedID": "9525897",
                    "doi": "10.1074/jbc.273.14.7988"
                },
                {
                    "title": "The Y-chromosomal genes SRY and ZFY are transcribed in adult human brain.",
                    "pubmedID": "10732804",
                    "doi": "10.1007/s100480050042"
                },
                {
                    "title": "A direct role of SRY and SOX proteins in pre-mRNA splicing.",
                    "pubmedID": "11818535",
                    "doi": "10.1073/pnas.022645899"
                },
                {
                    "title": "Transcriptional activity of testis-determining factor SRY is modulated by the Wilms' tumor 1 gene product, WT1.",
                    "pubmedID": "12970737",
                    "doi": "10.1038/sj.onc.1206717"
                },
                {
                    "title": "Defective importin beta recognition and nuclear import of the sex-determining factor SRY are associated with XY sex-reversing mutations.",
                    "pubmedID": "12764225",
                    "doi": "10.1073/pnas.1137864100"
                },
                {
                    "title": "Recombinant expression, purification and characterisation of the HMG domain of human SRY.",
                    "pubmedID": "12871148",
                    "doi": "10.2174/0929866033479004"
                },
                {
                    "title": "Sry-directed sex reversal in transgenic mice is robust with respect to enhanced DNA bending: comparison of human and murine HMG boxes.",
                    "pubmedID": "15170344",
                    "doi": "10.1021/bi049920a"
                },
                {
                    "title": "Regulation of human SRY subcellular distribution by its acetylation/deacetylation.",
                    "pubmedID": "15297880",
                    "doi": "10.1038/sj.emboj.7600352"
                },
                {
                    "title": "Sry associates with the heterochromatin protein 1 complex by interacting with a KRAB domain protein.",
                    "pubmedID": "15469996",
                    "doi": "10.1095/biolreprod.104.034447"
                },
                {
                    "title": "Defective calmodulin-mediated nuclear transport of the sex-determining region of the Y chromosome (SRY) in XY sex reversal.",
                    "pubmedID": "15746192",
                    "doi": "10.1210/me.2004-0334"
                },
                {
                    "title": "SRY-directed DNA bending and human sex reversal: reassessment of a clinical mutation uncovers a global coupling between the HMG box and its tail.",
                    "pubmedID": "16762365",
                    "doi": "10.1016/j.jmb.2006.04.048"
                },
                {
                    "title": "The poly(ADP-ribose) polymerase 1 interacts with Sry and modulates its biological functions.",
                    "pubmedID": "16904257",
                    "doi": "10.1016/j.mce.2006.06.008"
                },
                {
                    "title": "Exportin 4 mediates a novel nuclear import pathway for Sox family transcription factors.",
                    "pubmedID": "19349578",
                    "doi": "10.1083/jcb.200810106"
                },
                {
                    "title": "Sry and the hesitant beginnings of male development.",
                    "pubmedID": "16996051",
                    "doi": "10.1016/j.ydbio.2006.08.049"
                },
                {
                    "title": "KRAB: a partner for SRY action on chromatin.",
                    "pubmedID": "16414182",
                    "doi": "10.1016/j.mce.2005.12.011"
                },
                {
                    "title": "Molecular basis of human 46X,Y sex reversal revealed from the three-dimensional solution structure of the human SRY-DNA complex.",
                    "pubmedID": "7774012",
                    "doi": "10.1016/0092-8674(95)90532-4"
                },
                {
                    "title": "Structural basis for SRY-dependent 46-X,Y sex reversal: modulation of DNA bending by a naturally occurring point mutation.",
                    "pubmedID": "11563911",
                    "doi": "10.1006/jmbi.2001.4977"
                },
                {
                    "title": "Structure of a complex of tandem HMG boxes and DNA.",
                    "pubmedID": "16813837",
                    "doi": "10.1016/j.jmb.2006.04.059"
                },
                {
                    "title": "Mutational analysis of SRY in XY females.",
                    "pubmedID": "8257986",
                    "doi": "10.1002/humu.1380020504"
                },
                {
                    "title": "Mutations in SRY and SOX9: testis-determining genes.",
                    "pubmedID": "9143916",
                    "doi": "10.1002/(sici)1098-1004(1997)9:5<388::aid-humu2>3.0.co;2-0"
                },
                {
                    "title": "Genetic evidence equating SRY and the testis-determining factor.",
                    "pubmedID": "2247149",
                    "doi": "10.1038/348448a0"
                },
                {
                    "title": "Analysis of the SRY gene in 22 sex-reversed XY females identifies four new point mutations in the conserved DNA binding domain.",
                    "pubmedID": "8353496",
                    "doi": "10.1093/hmg/2.6.785"
                },
                {
                    "title": "Familial case with sequence variant in the testis-determining region associated with two sex phenotypes.",
                    "pubmedID": "1570829"
                },
                {
                    "title": "Evidence for increased prevalence of SRY mutations in XY females with complete rather than partial gonadal dysgenesis.",
                    "pubmedID": "1415266"
                },
                {
                    "title": "Mutational analysis of SRY: nonsense and missense mutations in XY sex reversal.",
                    "pubmedID": "1339396",
                    "doi": "10.1007/bf00215684"
                },
                {
                    "title": "True hermaphroditism in a 46,XY individual, caused by a postzygotic somatic point mutation in the male gonadal sex-determining locus (SRY): molecular genetics and histological findings in a sporadic case.",
                    "pubmedID": "8447323"
                },
                {
                    "title": "A familial mutation in the testis-determining gene SRY shared by both sexes.",
                    "pubmedID": "1483689",
                    "doi": "10.1007/bf00220457"
                },
                {
                    "title": "A new de novo mutation (A113T) in HMG box of the SRY gene leads to XY gonadal dysgenesis.",
                    "pubmedID": "8105086",
                    "doi": "10.1136/jmg.30.8.655"
                },
                {
                    "title": "Description and functional implications of a novel mutation in the sex-determining gene SRY.",
                    "pubmedID": "8019555",
                    "doi": "10.1002/humu.1380030305"
                },
                {
                    "title": "Molecular basis of mammalian sexual determination: activation of Mullerian inhibiting substance gene expression by SRY.",
                    "pubmedID": "7985018",
                    "doi": "10.1126/science.7985018"
                },
                {
                    "title": "Two novel SRY missense mutations reducing DNA binding identified in XY females and their mosaic fathers.",
                    "pubmedID": "7717397"
                },
                {
                    "title": "True hermaphroditism with 46,XY karyotype and a point mutation in the SRY gene.",
                    "pubmedID": "7776083",
                    "doi": "10.1016/s0022-3476(95)70247-4"
                },
                {
                    "title": "Three novel SRY mutations in XY gonadal dysgenesis and the enigma of XY gonadal dysgenesis cases without SRY mutations.",
                    "pubmedID": "9678356",
                    "doi": "10.1159/000014978"
                },
                {
                    "title": "A novel missense mutation (S18N) in the 5' non-HMG box region of the SRY gene in a patient with partial gonadal dysgenesis and his normal male relatives.",
                    "pubmedID": "9521592",
                    "doi": "10.1007/s004390050680"
                },
                {
                    "title": "Independent observation of SRY mutation I90M in a patient with complete gonadal dysgenesis.",
                    "pubmedID": "9450909",
                    "doi": "10.1002/(sici)1098-1004(1998)11:1<90::aid-humu14>3.0.co;2-u"
                },
                {
                    "title": "A rare case of 46,XX true hermaphroditism with hidden mosaicism with sex-determining region Y chromosome-bearing cells in the gonads.",
                    "pubmedID": "9652903",
                    "doi": "10.2169/internalmedicine.37.467"
                },
                {
                    "title": "A novel sex-determining region on Y (SRY) missense mutation identified in a 46,XY female and also in the father.",
                    "pubmedID": "10670762",
                    "doi": "10.1507/endocrj.46.735"
                },
                {
                    "title": "SRY gene transferred to the long arm of the X chromosome in a Y-positive XX true hermaphrodite.",
                    "pubmedID": "10602113",
                    "doi": "10.1002/(sici)1096-8628(20000103)90:1<25::aid-ajmg5>3.0.co;2-5"
                },
                {
                    "title": "Identification of a new missense mutation (Gly95Glu) in a highly conserved codon within the high-mobility group box of the sex-determining region Y gene: report on a 46,XY female with gonadal dysgenesis and yolk-sac tumor.",
                    "pubmedID": "10852465",
                    "doi": "10.1210/jcem.85.6.6637"
                },
                {
                    "title": "A mutation in the 5' non-high mobility group box region of the SRY gene in patients with Turner syndrome and Y mosaicism.",
                    "pubmedID": "10843173",
                    "doi": "10.1210/jcem.85.5.6609"
                },
                {
                    "title": "A novel missense mutation in the HMG box region of the SRY gene in a Japanese patient with an XY sex reversal.",
                    "pubmedID": "10721678",
                    "doi": "10.1007/s100380050026"
                },
                {
                    "title": "Familial mutation in the testis-determining gene SRY shared by an XY female and her normal father.",
                    "pubmedID": "12107262",
                    "doi": "10.1210/jcem.87.7.8646"
                },
                {
                    "title": "True hermaphroditism in an XY individual due to a familial point mutation of the SRY gene.",
                    "pubmedID": "12793612",
                    "doi": "10.1515/jpem.2003.16.4.575"
                },
                {
                    "title": "Identification and molecular modelling of a novel familial mutation in the SRY gene implicated in the pure gonadal dysgenesis.",
                    "pubmedID": "17063144",
                    "doi": "10.1038/sj.ejhg.5201719"
                },
                {
                    "title": "A novel missense mutation 224G>T (R75M) in SRY coding region interferes with nuclear import and results in 46, XY complete gonadal dysgenesis.",
                    "pubmedID": "28030592",
                    "doi": "10.1371/journal.pone.0168484"
                }
            ],
            "sequence": {
                "length": 204,
                "mass": 23884,
                "checksum": "84323C30A9C2173E",
                "modified": {
                    "$date": {
                        "$numberLong": "770428800000"
                    }
                },
                "version": 1,
                "sequence": "MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 3401268527
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}