Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 6755
{
"geneID": 6755,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC009041.10"
]
},
"genePos": {
"start": 4992,
"end": 13699
},
"orientation": true,
"symbol": "SSTR5",
"created": {
"$date": {
"$numberLong": "1738333349190"
}
},
"crossReference": {
"enseGeneID": "ENSG00000162009",
"enseRnaID": [
"ENST00000293897.7"
],
"enseProtID": [
"ENSP00000293897.4"
]
},
"chrom": {
"pos": "16",
"type": 1,
"loc": "16p13.3"
},
"desc": "somatostatin receptor 5",
"geneType": 5,
"mim": [
{
"id": 182455,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-162582",
"term": "Signal Transduction",
"cat": 10
},
{
"id": "R-HSA-372790",
"term": "Signaling by GPCR",
"cat": 11
},
{
"id": "R-HSA-388396",
"term": "GPCR downstream signalling",
"cat": 12
},
{
"id": "R-HSA-500792",
"term": "GPCR ligand binding",
"cat": 12
},
{
"id": "R-HSA-373076",
"term": "Class A/1 (Rhodopsin-like receptors)",
"cat": 13
},
{
"id": "R-HSA-418594",
"term": "G alpha (i) signalling events",
"cat": 13
},
{
"id": "R-HSA-375276",
"term": "Peptide ligand-binding receptors",
"cat": 14
},
{
"id": "GO:0004994",
"term": "somatostatin receptor activity",
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
15247250,
18653781,
19426801
],
"cat": 0
},
{
"id": "GO:0042923",
"term": "neuropeptide binding",
"cat": 0
},
{
"id": "GO:0007186",
"term": "G protein-coupled receptor signaling pathway",
"pubMed": [
9892014
],
"cat": 1
},
{
"id": "GO:0007187",
"term": "G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger",
"cat": 1
},
{
"id": "GO:0007218",
"term": "neuropeptide signaling pathway",
"cat": 1
},
{
"id": "GO:0008285",
"term": "negative regulation of cell population proliferation",
"cat": 1
},
{
"id": "GO:0032467",
"term": "positive regulation of cytokinesis",
"pubMed": [
22888021
],
"cat": 1
},
{
"id": "GO:0038170",
"term": "somatostatin signaling pathway",
"cat": 1
},
{
"id": "GO:0050796",
"term": "regulation of insulin secretion",
"cat": 1
},
{
"id": "GO:0071385",
"term": "cellular response to glucocorticoid stimulus",
"cat": 1
},
{
"id": "GO:0005886",
"term": "plasma membrane",
"cat": 2
},
{
"id": "GO:0043005",
"term": "neuron projection",
"cat": 2
}
],
"protein": [
{
"symbol": "SSR5_HUMAN",
"name": "Somatostatin receptor type 5",
"accession": [
"P35346",
"P34988",
"Q541E0",
"Q9UJI5"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"L14865",
"D16827",
"AY081193",
"AE006466",
"AL031713",
"CH471112"
],
"CCDS": [
"CCDS10429.1"
],
"PIR": [
"I57955",
"JN0763"
],
"RefSeq": [
"NP_001044.1",
"NP_001166031.1"
],
"PDB": [
"8X8L",
"8X8N"
],
"PDBsum": [
"8X8L",
"8X8N"
],
"AlphaFoldDB": [
"P35346"
],
"EMDB": [
"EMD-38148",
"EMD-38150"
],
"SMR": [
"P35346"
],
"BioGRID": [
"112633"
],
"CORUM": [
"P35346"
],
"IntAct": [
"P35346"
],
"STRING": [
"9606.ENSP00000293897"
],
"BindingDB": [
"P35346"
],
"ChEMBL": [
"CHEMBL1792"
],
"DrugBank": [
"DB15494",
"DB06791",
"DB13985",
"DB06663",
"DB09099",
"DB04894"
],
"DrugCentral": [
"P35346"
],
"GuidetoPHARMACOLOGY": [
"359"
],
"GlyCosmos": [
"P35346"
],
"GlyGen": [
"P35346"
],
"iPTMnet": [
"P35346"
],
"PhosphoSitePlus": [
"P35346"
],
"BioMuta": [
"SSTR5"
],
"DMDM": [
"12644225"
],
"jPOST": [
"P35346"
],
"PaxDb": [
"9606-ENSP00000293897"
],
"PeptideAtlas": [
"P35346"
],
"ProteomicsDB": [
"55025"
],
"Antibodypedia": [
"3358"
],
"DNASU": [
"6755"
],
"Ensembl": [
"ENST00000293897.7",
"ENST00000689027.1",
"ENST00000711615.1"
],
"KEGG": [
"hsa:6755"
],
"MANE-Select": [
"ENST00000689027.1"
],
"UCSC": [
"uc002ckq.4"
],
"AGR": [
"HGNC:11334"
],
"CTD": [
"6755"
],
"DisGeNET": [
"6755"
],
"GeneCards": [
"SSTR5"
],
"HGNC": [
"HGNC:11334"
],
"HPA": [
"ENSG00000162009"
],
"MIM": [
"182455"
],
"neXtProt": [
"NX_P35346"
],
"OpenTargets": [
"ENSG00000162009"
],
"PharmGKB": [
"PA36158"
],
"VEuPathDB": [
"HostDB:ENSG00000162009"
],
"eggNOG": [
"KOG3656"
],
"GeneTree": [
"ENSGT00940000160265"
],
"HOGENOM": [
"CLU_009579_8_1_1"
],
"InParanoid": [
"P35346"
],
"OMA": [
"QEDFQTC"
],
"OrthoDB": [
"5393360at2759"
],
"PhylomeDB": [
"P35346"
],
"TreeFam": [
"TF315737"
],
"PathwayCommons": [
"P35346"
],
"Reactome": [
"R-HSA-375276",
"R-HSA-418594"
],
"SignaLink": [
"P35346"
],
"SIGNOR": [
"P35346"
],
"BioGRID-ORCS": [
"6755"
],
"ChiTaRS": [
"SSTR5"
],
"GeneWiki": [
"Somatostatin_receptor_5"
],
"GenomeRNAi": [
"6755"
],
"Pharos": [
"P35346"
],
"PRO": [
"PR:P35346"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P35346"
],
"Bgee": [
"ENSG00000162009"
],
"GO": [
"GO:0043005",
"GO:0005886",
"GO:0042923",
"GO:0004994",
"GO:0071385",
"GO:0007186",
"GO:0007187",
"GO:0008285",
"GO:0007218",
"GO:0032467",
"GO:0050796"
],
"CDD": [
"cd15974"
],
"Gene3D": [
"1.20.1070.10"
],
"InterPro": [
"IPR000276",
"IPR017452",
"IPR000586",
"IPR001184"
],
"PANTHER": [
"PTHR24229",
"PTHR24229:SF20"
],
"Pfam": [
"PF00001"
],
"PRINTS": [
"PR00237",
"PR00246",
"PR00591"
],
"SMART": [
"SM01381"
],
"SUPFAM": [
"SSF81321"
],
"PROSITE": [
"PS00237",
"PS50262"
]
},
"citations": [
{
"title": "Molecular cloning, functional characterization, and chromosomal localization of a human somatostatin receptor (somatostatin receptor type 5) with preferential affinity for somatostatin-28.",
"pubmedID": "7908405"
},
{
"title": "Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.",
"pubmedID": "8373420",
"doi": "10.1006/bbrc.1993.2122"
},
{
"title": "Characterization of cloned human somatostatin receptor SSTR5.",
"pubmedID": "8078491"
},
{
"title": "Identification of an upstream pituitary-active promoter of human somatostatin receptor subtype 5.",
"pubmedID": "12072395",
"doi": "10.1210/endo.143.7.8883"
},
{
"title": "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.",
"pubmedID": "11157797",
"doi": "10.1093/hmg/10.4.339"
},
{
"title": "The sequence and analysis of duplication-rich human chromosome 16.",
"pubmedID": "15616553",
"doi": "10.1038/nature03187"
},
{
"title": "Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization.",
"pubmedID": "18653781",
"doi": "10.1210/me.2007-0334"
},
{
"title": "Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase.",
"pubmedID": "21820437",
"doi": "10.1016/j.febslet.2011.07.028"
}
],
"sequence": {
"length": 364,
"mass": 39202,
"checksum": "905744715F31121C",
"modified": {
"$date": {
"$numberLong": "975628800000"
}
},
"version": 3,
"sequence": "MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL"
},
"existence": 0,
"relevance": 1,
"proteinID": 1760088671
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}