Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 6755

{
    "geneID": 6755,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC009041.10"
        ]
    },
    "genePos": {
        "start": 4992,
        "end": 13699
    },
    "orientation": true,
    "symbol": "SSTR5",
    "created": {
        "$date": {
            "$numberLong": "1738333349190"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000162009",
        "enseRnaID": [
            "ENST00000293897.7"
        ],
        "enseProtID": [
            "ENSP00000293897.4"
        ]
    },
    "chrom": {
        "pos": "16",
        "type": 1,
        "loc": "16p13.3"
    },
    "desc": "somatostatin receptor 5",
    "geneType": 5,
    "mim": [
        {
            "id": 182455,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-162582",
            "term": "Signal Transduction",
            "cat": 10
        },
        {
            "id": "R-HSA-372790",
            "term": "Signaling by GPCR",
            "cat": 11
        },
        {
            "id": "R-HSA-388396",
            "term": "GPCR downstream signalling",
            "cat": 12
        },
        {
            "id": "R-HSA-500792",
            "term": "GPCR ligand binding",
            "cat": 12
        },
        {
            "id": "R-HSA-373076",
            "term": "Class A/1 (Rhodopsin-like receptors)",
            "cat": 13
        },
        {
            "id": "R-HSA-418594",
            "term": "G alpha (i) signalling events",
            "cat": 13
        },
        {
            "id": "R-HSA-375276",
            "term": "Peptide ligand-binding receptors",
            "cat": 14
        },
        {
            "id": "GO:0004994",
            "term": "somatostatin receptor activity",
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                15247250,
                18653781,
                19426801
            ],
            "cat": 0
        },
        {
            "id": "GO:0042923",
            "term": "neuropeptide binding",
            "cat": 0
        },
        {
            "id": "GO:0007186",
            "term": "G protein-coupled receptor signaling pathway",
            "pubMed": [
                9892014
            ],
            "cat": 1
        },
        {
            "id": "GO:0007187",
            "term": "G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger",
            "cat": 1
        },
        {
            "id": "GO:0007218",
            "term": "neuropeptide signaling pathway",
            "cat": 1
        },
        {
            "id": "GO:0008285",
            "term": "negative regulation of cell population proliferation",
            "cat": 1
        },
        {
            "id": "GO:0032467",
            "term": "positive regulation of cytokinesis",
            "pubMed": [
                22888021
            ],
            "cat": 1
        },
        {
            "id": "GO:0038170",
            "term": "somatostatin signaling pathway",
            "cat": 1
        },
        {
            "id": "GO:0050796",
            "term": "regulation of insulin secretion",
            "cat": 1
        },
        {
            "id": "GO:0071385",
            "term": "cellular response to glucocorticoid stimulus",
            "cat": 1
        },
        {
            "id": "GO:0005886",
            "term": "plasma membrane",
            "cat": 2
        },
        {
            "id": "GO:0043005",
            "term": "neuron projection",
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "SSR5_HUMAN",
            "name": "Somatostatin receptor type 5",
            "accession": [
                "P35346",
                "P34988",
                "Q541E0",
                "Q9UJI5"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "L14865",
                    "D16827",
                    "AY081193",
                    "AE006466",
                    "AL031713",
                    "CH471112"
                ],
                "CCDS": [
                    "CCDS10429.1"
                ],
                "PIR": [
                    "I57955",
                    "JN0763"
                ],
                "RefSeq": [
                    "NP_001044.1",
                    "NP_001166031.1"
                ],
                "PDB": [
                    "8X8L",
                    "8X8N"
                ],
                "PDBsum": [
                    "8X8L",
                    "8X8N"
                ],
                "AlphaFoldDB": [
                    "P35346"
                ],
                "EMDB": [
                    "EMD-38148",
                    "EMD-38150"
                ],
                "SMR": [
                    "P35346"
                ],
                "BioGRID": [
                    "112633"
                ],
                "CORUM": [
                    "P35346"
                ],
                "IntAct": [
                    "P35346"
                ],
                "STRING": [
                    "9606.ENSP00000293897"
                ],
                "BindingDB": [
                    "P35346"
                ],
                "ChEMBL": [
                    "CHEMBL1792"
                ],
                "DrugBank": [
                    "DB15494",
                    "DB06791",
                    "DB13985",
                    "DB06663",
                    "DB09099",
                    "DB04894"
                ],
                "DrugCentral": [
                    "P35346"
                ],
                "GuidetoPHARMACOLOGY": [
                    "359"
                ],
                "GlyCosmos": [
                    "P35346"
                ],
                "GlyGen": [
                    "P35346"
                ],
                "iPTMnet": [
                    "P35346"
                ],
                "PhosphoSitePlus": [
                    "P35346"
                ],
                "BioMuta": [
                    "SSTR5"
                ],
                "DMDM": [
                    "12644225"
                ],
                "jPOST": [
                    "P35346"
                ],
                "PaxDb": [
                    "9606-ENSP00000293897"
                ],
                "PeptideAtlas": [
                    "P35346"
                ],
                "ProteomicsDB": [
                    "55025"
                ],
                "Antibodypedia": [
                    "3358"
                ],
                "DNASU": [
                    "6755"
                ],
                "Ensembl": [
                    "ENST00000293897.7",
                    "ENST00000689027.1",
                    "ENST00000711615.1"
                ],
                "KEGG": [
                    "hsa:6755"
                ],
                "MANE-Select": [
                    "ENST00000689027.1"
                ],
                "UCSC": [
                    "uc002ckq.4"
                ],
                "AGR": [
                    "HGNC:11334"
                ],
                "CTD": [
                    "6755"
                ],
                "DisGeNET": [
                    "6755"
                ],
                "GeneCards": [
                    "SSTR5"
                ],
                "HGNC": [
                    "HGNC:11334"
                ],
                "HPA": [
                    "ENSG00000162009"
                ],
                "MIM": [
                    "182455"
                ],
                "neXtProt": [
                    "NX_P35346"
                ],
                "OpenTargets": [
                    "ENSG00000162009"
                ],
                "PharmGKB": [
                    "PA36158"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000162009"
                ],
                "eggNOG": [
                    "KOG3656"
                ],
                "GeneTree": [
                    "ENSGT00940000160265"
                ],
                "HOGENOM": [
                    "CLU_009579_8_1_1"
                ],
                "InParanoid": [
                    "P35346"
                ],
                "OMA": [
                    "QEDFQTC"
                ],
                "OrthoDB": [
                    "5393360at2759"
                ],
                "PhylomeDB": [
                    "P35346"
                ],
                "TreeFam": [
                    "TF315737"
                ],
                "PathwayCommons": [
                    "P35346"
                ],
                "Reactome": [
                    "R-HSA-375276",
                    "R-HSA-418594"
                ],
                "SignaLink": [
                    "P35346"
                ],
                "SIGNOR": [
                    "P35346"
                ],
                "BioGRID-ORCS": [
                    "6755"
                ],
                "ChiTaRS": [
                    "SSTR5"
                ],
                "GeneWiki": [
                    "Somatostatin_receptor_5"
                ],
                "GenomeRNAi": [
                    "6755"
                ],
                "Pharos": [
                    "P35346"
                ],
                "PRO": [
                    "PR:P35346"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P35346"
                ],
                "Bgee": [
                    "ENSG00000162009"
                ],
                "GO": [
                    "GO:0043005",
                    "GO:0005886",
                    "GO:0042923",
                    "GO:0004994",
                    "GO:0071385",
                    "GO:0007186",
                    "GO:0007187",
                    "GO:0008285",
                    "GO:0007218",
                    "GO:0032467",
                    "GO:0050796"
                ],
                "CDD": [
                    "cd15974"
                ],
                "Gene3D": [
                    "1.20.1070.10"
                ],
                "InterPro": [
                    "IPR000276",
                    "IPR017452",
                    "IPR000586",
                    "IPR001184"
                ],
                "PANTHER": [
                    "PTHR24229",
                    "PTHR24229:SF20"
                ],
                "Pfam": [
                    "PF00001"
                ],
                "PRINTS": [
                    "PR00237",
                    "PR00246",
                    "PR00591"
                ],
                "SMART": [
                    "SM01381"
                ],
                "SUPFAM": [
                    "SSF81321"
                ],
                "PROSITE": [
                    "PS00237",
                    "PS50262"
                ]
            },
            "citations": [
                {
                    "title": "Molecular cloning, functional characterization, and chromosomal localization of a human somatostatin receptor (somatostatin receptor type 5) with preferential affinity for somatostatin-28.",
                    "pubmedID": "7908405"
                },
                {
                    "title": "Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.",
                    "pubmedID": "8373420",
                    "doi": "10.1006/bbrc.1993.2122"
                },
                {
                    "title": "Characterization of cloned human somatostatin receptor SSTR5.",
                    "pubmedID": "8078491"
                },
                {
                    "title": "Identification of an upstream pituitary-active promoter of human somatostatin receptor subtype 5.",
                    "pubmedID": "12072395",
                    "doi": "10.1210/endo.143.7.8883"
                },
                {
                    "title": "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.",
                    "pubmedID": "11157797",
                    "doi": "10.1093/hmg/10.4.339"
                },
                {
                    "title": "The sequence and analysis of duplication-rich human chromosome 16.",
                    "pubmedID": "15616553",
                    "doi": "10.1038/nature03187"
                },
                {
                    "title": "Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization.",
                    "pubmedID": "18653781",
                    "doi": "10.1210/me.2007-0334"
                },
                {
                    "title": "Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase.",
                    "pubmedID": "21820437",
                    "doi": "10.1016/j.febslet.2011.07.028"
                }
            ],
            "sequence": {
                "length": 364,
                "mass": 39202,
                "checksum": "905744715F31121C",
                "modified": {
                    "$date": {
                        "$numberLong": "975628800000"
                    }
                },
                "version": 3,
                "sequence": "MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 1760088671
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}