Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 6756
{
"geneID": 6756,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC245047.1"
]
},
"genePos": {
"start": 5031,
"end": 17083
},
"orientation": false,
"symbol": "SSX1",
"created": {
"$date": {
"$numberLong": "1738333349190"
}
},
"crossReference": {
"enseGeneID": "ENSG00000126752",
"enseRnaID": [
"ENST00000376919.4"
],
"enseProtID": [
"ENSP00000366118.3"
]
},
"chrom": {
"loc": "Xp11.23"
},
"desc": "SSX family member 1",
"geneType": 5,
"mim": [
{
"id": 301099,
"relation": 1,
"cui": 5829558
},
{
"id": 312820,
"relation": 0
}
],
"ontology": [
{
"id": "GO:0003714",
"term": "transcription corepressor activity",
"pubMed": [
10072425
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
25416956,
32296183
],
"cat": 0
},
{
"id": "GO:0000122",
"term": "negative regulation of transcription by RNA polymerase II",
"pubMed": [
10072425
],
"cat": 1
},
{
"id": "GO:0007283",
"term": "spermatogenesis",
"pubMed": [
36796361
],
"cat": 1
},
{
"id": "GO:0005634",
"term": "nucleus",
"cat": 2
},
{
"id": "GO:0005634",
"term": "nucleus",
"pubMed": [
10072425
],
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
},
{
"id": "GO:0005856",
"term": "cytoskeleton",
"cat": 2
},
{
"id": "GO:0036126",
"term": "sperm flagellum",
"pubMed": [
36796361
],
"cat": 2
}
],
"geneRelations": [
{
"type": 8,
"similarGenes": [
"100996564"
]
}
],
"protein": [
{
"symbol": "SSX1_HUMAN",
"name": "Protein SSX1",
"accession": [
"Q16384",
"A3KN76",
"Q08AJ2",
"Q5JQ64"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"MIM": [
"301099",
"301099",
"312820"
],
"EMBL": [
"X86174",
"AL683817",
"BC001003",
"BC125151",
"BC128611",
"BC133693",
"BC150487",
"S79325"
],
"CCDS": [
"CCDS14290.1"
],
"PIR": [
"S55057"
],
"RefSeq": [
"NP_001265620.1",
"NP_005626.1"
],
"PDB": [
"8HR1"
],
"PDBsum": [
"8HR1"
],
"AlphaFoldDB": [
"Q16384"
],
"EMDB": [
"EMD-34956"
],
"SMR": [
"Q16384"
],
"BioGRID": [
"112634"
],
"IntAct": [
"Q16384"
],
"STRING": [
"9606.ENSP00000366118"
],
"iPTMnet": [
"Q16384"
],
"PhosphoSitePlus": [
"Q16384"
],
"BioMuta": [
"SSX1"
],
"DMDM": [
"3915027"
],
"MassIVE": [
"Q16384"
],
"PaxDb": [
"9606-ENSP00000366118"
],
"PeptideAtlas": [
"Q16384"
],
"ProteomicsDB": [
"60866"
],
"Pumba": [
"Q16384"
],
"Antibodypedia": [
"25598"
],
"DNASU": [
"6756"
],
"Ensembl": [
"ENST00000376919.4"
],
"KEGG": [
"hsa:6756"
],
"MANE-Select": [
"ENST00000376919.4"
],
"UCSC": [
"uc004djb.2"
],
"AGR": [
"HGNC:11335"
],
"CTD": [
"6756"
],
"DisGeNET": [
"6756"
],
"GeneCards": [
"SSX1"
],
"HGNC": [
"HGNC:11335"
],
"HPA": [
"ENSG00000126752"
],
"MalaCards": [
"SSX1"
],
"neXtProt": [
"NX_Q16384"
],
"OpenTargets": [
"ENSG00000126752"
],
"Orphanet": [
"3273"
],
"PharmGKB": [
"PA36159"
],
"VEuPathDB": [
"HostDB:ENSG00000126752"
],
"eggNOG": [
"ENOG502RU1A"
],
"GeneTree": [
"ENSGT00390000012484"
],
"HOGENOM": [
"CLU_097196_1_0_1"
],
"InParanoid": [
"Q16384"
],
"OMA": [
"PPAFMCP"
],
"OrthoDB": [
"4665403at2759"
],
"PhylomeDB": [
"Q16384"
],
"TreeFam": [
"TF338517"
],
"PathwayCommons": [
"Q16384"
],
"SignaLink": [
"Q16384"
],
"BioGRID-ORCS": [
"6756"
],
"ChiTaRS": [
"SSX1"
],
"GeneWiki": [
"SSX1"
],
"GenomeRNAi": [
"6756"
],
"Pharos": [
"Q16384"
],
"PRO": [
"PR:Q16384"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"Q16384"
],
"Bgee": [
"ENSG00000126752"
],
"GO": [
"GO:0005737",
"GO:0005856",
"GO:0005634",
"GO:0036126",
"GO:0003714",
"GO:0000122",
"GO:0007283"
],
"InterPro": [
"IPR003655",
"IPR001909",
"IPR036051",
"IPR019041"
],
"PANTHER": [
"PTHR14112:SF26",
"PTHR14112"
],
"Pfam": [
"PF09514"
],
"SMART": [
"SM00349"
],
"SUPFAM": [
"SSF109640"
],
"PROSITE": [
"PS50806"
]
},
"citations": [
{
"title": "Fusion of SYT to two genes, SSX1 and SSX2, encoding proteins with homology to the Kruppel-associated box in human synovial sarcoma.",
"pubmedID": "7539744",
"doi": "10.1002/j.1460-2075.1995.tb07228.x"
},
{
"title": "The DNA sequence of the human X chromosome.",
"pubmedID": "15772651",
"doi": "10.1038/nature03440"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
},
{
"title": "Identification of two alternative fusion genes, SYT-SSX1 and SYT-SSX2, in t(X;18)(p11.2;q11.2)-positive synovial sarcomas.",
"pubmedID": "7655467",
"doi": "10.1093/hmg/4.6.1097"
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"pubmedID": "23186163",
"doi": "10.1021/pr300630k"
},
{
"title": "Deficiency of primate-specific SSX1 induced asthenoteratozoospermia in infertile men and cynomolgus monkey and tree shrew models.",
"pubmedID": "36796361",
"doi": "10.1016/j.ajhg.2023.01.016"
}
],
"sequence": {
"length": 188,
"mass": 21931,
"checksum": "E440D1B2AE3AE9F7",
"modified": {
"$date": {
"$numberLong": "913680000000"
}
},
"version": 2,
"sequence": "MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE"
},
"existence": 0,
"relevance": 1,
"proteinID": 3777243702
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}