Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 6756

{
    "geneID": 6756,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC245047.1"
        ]
    },
    "genePos": {
        "start": 5031,
        "end": 17083
    },
    "orientation": false,
    "symbol": "SSX1",
    "created": {
        "$date": {
            "$numberLong": "1738333349190"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000126752",
        "enseRnaID": [
            "ENST00000376919.4"
        ],
        "enseProtID": [
            "ENSP00000366118.3"
        ]
    },
    "chrom": {
        "loc": "Xp11.23"
    },
    "desc": "SSX family member 1",
    "geneType": 5,
    "mim": [
        {
            "id": 301099,
            "relation": 1,
            "cui": 5829558
        },
        {
            "id": 312820,
            "relation": 0
        }
    ],
    "ontology": [
        {
            "id": "GO:0003714",
            "term": "transcription corepressor activity",
            "pubMed": [
                10072425
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                25416956,
                32296183
            ],
            "cat": 0
        },
        {
            "id": "GO:0000122",
            "term": "negative regulation of transcription by RNA polymerase II",
            "pubMed": [
                10072425
            ],
            "cat": 1
        },
        {
            "id": "GO:0007283",
            "term": "spermatogenesis",
            "pubMed": [
                36796361
            ],
            "cat": 1
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "cat": 2
        },
        {
            "id": "GO:0005634",
            "term": "nucleus",
            "pubMed": [
                10072425
            ],
            "cat": 2
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "cat": 2
        },
        {
            "id": "GO:0005856",
            "term": "cytoskeleton",
            "cat": 2
        },
        {
            "id": "GO:0036126",
            "term": "sperm flagellum",
            "pubMed": [
                36796361
            ],
            "cat": 2
        }
    ],
    "geneRelations": [
        {
            "type": 8,
            "similarGenes": [
                "100996564"
            ]
        }
    ],
    "protein": [
        {
            "symbol": "SSX1_HUMAN",
            "name": "Protein SSX1",
            "accession": [
                "Q16384",
                "A3KN76",
                "Q08AJ2",
                "Q5JQ64"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "MIM": [
                    "301099",
                    "301099",
                    "312820"
                ],
                "EMBL": [
                    "X86174",
                    "AL683817",
                    "BC001003",
                    "BC125151",
                    "BC128611",
                    "BC133693",
                    "BC150487",
                    "S79325"
                ],
                "CCDS": [
                    "CCDS14290.1"
                ],
                "PIR": [
                    "S55057"
                ],
                "RefSeq": [
                    "NP_001265620.1",
                    "NP_005626.1"
                ],
                "PDB": [
                    "8HR1"
                ],
                "PDBsum": [
                    "8HR1"
                ],
                "AlphaFoldDB": [
                    "Q16384"
                ],
                "EMDB": [
                    "EMD-34956"
                ],
                "SMR": [
                    "Q16384"
                ],
                "BioGRID": [
                    "112634"
                ],
                "IntAct": [
                    "Q16384"
                ],
                "STRING": [
                    "9606.ENSP00000366118"
                ],
                "iPTMnet": [
                    "Q16384"
                ],
                "PhosphoSitePlus": [
                    "Q16384"
                ],
                "BioMuta": [
                    "SSX1"
                ],
                "DMDM": [
                    "3915027"
                ],
                "MassIVE": [
                    "Q16384"
                ],
                "PaxDb": [
                    "9606-ENSP00000366118"
                ],
                "PeptideAtlas": [
                    "Q16384"
                ],
                "ProteomicsDB": [
                    "60866"
                ],
                "Pumba": [
                    "Q16384"
                ],
                "Antibodypedia": [
                    "25598"
                ],
                "DNASU": [
                    "6756"
                ],
                "Ensembl": [
                    "ENST00000376919.4"
                ],
                "KEGG": [
                    "hsa:6756"
                ],
                "MANE-Select": [
                    "ENST00000376919.4"
                ],
                "UCSC": [
                    "uc004djb.2"
                ],
                "AGR": [
                    "HGNC:11335"
                ],
                "CTD": [
                    "6756"
                ],
                "DisGeNET": [
                    "6756"
                ],
                "GeneCards": [
                    "SSX1"
                ],
                "HGNC": [
                    "HGNC:11335"
                ],
                "HPA": [
                    "ENSG00000126752"
                ],
                "MalaCards": [
                    "SSX1"
                ],
                "neXtProt": [
                    "NX_Q16384"
                ],
                "OpenTargets": [
                    "ENSG00000126752"
                ],
                "Orphanet": [
                    "3273"
                ],
                "PharmGKB": [
                    "PA36159"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000126752"
                ],
                "eggNOG": [
                    "ENOG502RU1A"
                ],
                "GeneTree": [
                    "ENSGT00390000012484"
                ],
                "HOGENOM": [
                    "CLU_097196_1_0_1"
                ],
                "InParanoid": [
                    "Q16384"
                ],
                "OMA": [
                    "PPAFMCP"
                ],
                "OrthoDB": [
                    "4665403at2759"
                ],
                "PhylomeDB": [
                    "Q16384"
                ],
                "TreeFam": [
                    "TF338517"
                ],
                "PathwayCommons": [
                    "Q16384"
                ],
                "SignaLink": [
                    "Q16384"
                ],
                "BioGRID-ORCS": [
                    "6756"
                ],
                "ChiTaRS": [
                    "SSX1"
                ],
                "GeneWiki": [
                    "SSX1"
                ],
                "GenomeRNAi": [
                    "6756"
                ],
                "Pharos": [
                    "Q16384"
                ],
                "PRO": [
                    "PR:Q16384"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "Q16384"
                ],
                "Bgee": [
                    "ENSG00000126752"
                ],
                "GO": [
                    "GO:0005737",
                    "GO:0005856",
                    "GO:0005634",
                    "GO:0036126",
                    "GO:0003714",
                    "GO:0000122",
                    "GO:0007283"
                ],
                "InterPro": [
                    "IPR003655",
                    "IPR001909",
                    "IPR036051",
                    "IPR019041"
                ],
                "PANTHER": [
                    "PTHR14112:SF26",
                    "PTHR14112"
                ],
                "Pfam": [
                    "PF09514"
                ],
                "SMART": [
                    "SM00349"
                ],
                "SUPFAM": [
                    "SSF109640"
                ],
                "PROSITE": [
                    "PS50806"
                ]
            },
            "citations": [
                {
                    "title": "Fusion of SYT to two genes, SSX1 and SSX2, encoding proteins with homology to the Kruppel-associated box in human synovial sarcoma.",
                    "pubmedID": "7539744",
                    "doi": "10.1002/j.1460-2075.1995.tb07228.x"
                },
                {
                    "title": "The DNA sequence of the human X chromosome.",
                    "pubmedID": "15772651",
                    "doi": "10.1038/nature03440"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101/gr.2596504"
                },
                {
                    "title": "Identification of two alternative fusion genes, SYT-SSX1 and SYT-SSX2, in t(X;18)(p11.2;q11.2)-positive synovial sarcomas.",
                    "pubmedID": "7655467",
                    "doi": "10.1093/hmg/4.6.1097"
                },
                {
                    "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
                    "pubmedID": "23186163",
                    "doi": "10.1021/pr300630k"
                },
                {
                    "title": "Deficiency of primate-specific SSX1 induced asthenoteratozoospermia in infertile men and cynomolgus monkey and tree shrew models.",
                    "pubmedID": "36796361",
                    "doi": "10.1016/j.ajhg.2023.01.016"
                }
            ],
            "sequence": {
                "length": 188,
                "mass": 21931,
                "checksum": "E440D1B2AE3AE9F7",
                "modified": {
                    "$date": {
                        "$numberLong": "913680000000"
                    }
                },
                "version": 2,
                "sequence": "MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 3777243702
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}