Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 6758
{
"geneID": 6758,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC245047.1"
]
},
"genePos": {
"start": 48186220,
"end": 48196795
},
"orientation": true,
"symbol": "SSX5",
"created": {
"$date": {
"$numberLong": "1738333349190"
}
},
"crossReference": {
"enseGeneID": "ENSG00000165583",
"enseRnaID": [
"ENST00000311798.5"
],
"enseProtID": [
"ENSP00000312415.1"
]
},
"chrom": {
"loc": "Xp11.23"
},
"desc": "SSX family member 5",
"geneType": 5,
"mim": [
{
"id": 300327,
"relation": 0
}
],
"ontology": [
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
25416956,
29892012,
31515488,
32296183
],
"cat": 0
},
{
"id": "GO:0006355",
"term": "regulation of DNA-templated transcription",
"cat": 1
},
{
"id": "GO:0005634",
"term": "nucleus",
"cat": 2
}
],
"geneRelations": [
{
"type": 8,
"similarGenes": [
"100287603"
]
}
],
"protein": [
{
"symbol": "SSX5_HUMAN",
"name": "Protein SSX5",
"accession": [
"O60225",
"Q5JQ59",
"Q5JQ60",
"Q96AW3"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"U90842",
"AL683817",
"AL356464",
"AL683817",
"AL356464",
"AL356464",
"AL683817",
"AL356464",
"AL683817",
"BC016640"
],
"CCDS": [
"CCDS14288.1",
"CCDS14289.1"
],
"RefSeq": [
"NP_066295.3",
"NP_783729.1",
"XP_011542251.1",
"XP_016885247.1"
],
"AlphaFoldDB": [
"O60225"
],
"BioGRID": [
"112636"
],
"IntAct": [
"O60225"
],
"STRING": [
"9606.ENSP00000312415"
],
"iPTMnet": [
"O60225"
],
"PhosphoSitePlus": [
"O60225"
],
"BioMuta": [
"SSX5"
],
"MassIVE": [
"O60225"
],
"PeptideAtlas": [
"O60225"
],
"ProteomicsDB": [
"49250",
"49251"
],
"Antibodypedia": [
"25586"
],
"DNASU": [
"6758"
],
"Ensembl": [
"ENST00000311798.5",
"ENST00000347757.6"
],
"KEGG": [
"hsa:6758"
],
"MANE-Select": [
"ENST00000347757.6"
],
"UCSC": [
"uc004diz.1"
],
"AGR": [
"HGNC:11339"
],
"CTD": [
"6758"
],
"DisGeNET": [
"6758"
],
"GeneCards": [
"SSX5"
],
"HGNC": [
"HGNC:11339"
],
"HPA": [
"ENSG00000165583"
],
"MIM": [
"300327"
],
"neXtProt": [
"NX_O60225"
],
"OpenTargets": [
"ENSG00000165583"
],
"PharmGKB": [
"PA36163"
],
"VEuPathDB": [
"HostDB:ENSG00000165583"
],
"GeneTree": [
"ENSGT00390000012484"
],
"InParanoid": [
"O60225"
],
"OMA": [
"EYQPLER"
],
"OrthoDB": [
"4665403at2759"
],
"PhylomeDB": [
"O60225"
],
"TreeFam": [
"TF338517"
],
"PathwayCommons": [
"O60225"
],
"SignaLink": [
"O60225"
],
"BioGRID-ORCS": [
"6758"
],
"ChiTaRS": [
"SSX5"
],
"GeneWiki": [
"SSX5"
],
"GenomeRNAi": [
"6758"
],
"Pharos": [
"O60225"
],
"PRO": [
"PR:O60225"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"O60225"
],
"Bgee": [
"ENSG00000165583"
],
"GO": [
"GO:0005634",
"GO:0006355"
],
"InterPro": [
"IPR003655",
"IPR001909",
"IPR036051",
"IPR019041"
],
"PANTHER": [
"PTHR14112:SF23",
"PTHR14112"
],
"Pfam": [
"PF09514"
],
"SMART": [
"SM00349"
],
"SUPFAM": [
"SSF109640"
],
"PROSITE": [
"PS50806"
]
},
"citations": [
{
"title": "SSX: a multigene family with several members transcribed in normal testis and human cancer.",
"pubmedID": "9378559",
"doi": "10.1002/(sici)1097-0215(19970917)72:6<965::aid-ijc8>3.0.co;2-n"
},
{
"title": "The DNA sequence of the human X chromosome.",
"pubmedID": "15772651",
"doi": "10.1038/nature03440"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101/gr.2596504"
}
],
"sequence": {
"length": 188,
"mass": 21660,
"checksum": "DBFA61D8B1295A27",
"modified": {
"$date": {
"$numberLong": "1159833600000"
}
},
"version": 3,
"sequence": "MNGDDAFVRRPRVGSQIPEKMQKAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE"
},
"existence": 0,
"relevance": 1,
"proteinID": 433729578
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}