Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 8823
{
"geneID": 8823,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC243316.3"
]
},
"genePos": {
"start": 4715,
"end": 14604
},
"orientation": false,
"symbol": "FGF16",
"created": {
"$date": {
"$numberLong": "1738333349598"
}
},
"crossReference": {
"enseGeneID": "ENSG00000196468",
"enseRnaID": [
"ENST00000439435.3"
],
"enseProtID": [
"ENSP00000399324.2"
]
},
"chrom": {
"loc": "Xq21.1"
},
"desc": "fibroblast growth factor 16",
"geneType": 5,
"mim": [
{
"id": 300827,
"relation": 0
},
{
"id": 309630,
"relation": 1,
"cui": 1839728
}
],
"ontology": [
{
"id": "R-HSA-162582",
"term": "Signal Transduction",
"cat": 10
},
{
"id": "R-HSA-1643685",
"term": "Disease",
"cat": 10
},
{
"id": "R-HSA-5663202",
"term": "Diseases of signal transduction by growth factor receptors and second messengers",
"cat": 11
},
{
"id": "R-HSA-5683057",
"term": "MAPK family signaling cascades",
"cat": 11
},
{
"id": "R-HSA-9006925",
"term": "Intracellular signaling by second messengers",
"cat": 11
},
{
"id": "R-HSA-9006934",
"term": "Signaling by Receptor Tyrosine Kinases",
"cat": 11
},
{
"id": "R-HSA-1226099",
"term": "Signaling by FGFR in disease",
"cat": 12
},
{
"id": "R-HSA-1257604",
"term": "PIP3 activates AKT signaling",
"cat": 12
},
{
"id": "R-HSA-190236",
"term": "Signaling by FGFR",
"cat": 12
},
{
"id": "R-HSA-2219528",
"term": "PI3K/AKT Signaling in Cancer",
"cat": 12
},
{
"id": "R-HSA-2404192",
"term": "Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)",
"cat": 12
},
{
"id": "R-HSA-5684996",
"term": "MAPK1/MAPK3 signaling",
"cat": 12
},
{
"id": "R-HSA-74752",
"term": "Signaling by Insulin receptor",
"cat": 12
},
{
"id": "R-HSA-199418",
"term": "Negative regulation of the PI3K/AKT network",
"cat": 13
},
{
"id": "R-HSA-2219530",
"term": "Constitutive Signaling by Aberrant PI3K in Cancer",
"cat": 13
},
{
"id": "R-HSA-2428924",
"term": "IGF1R signaling cascade",
"cat": 13
},
{
"id": "R-HSA-5654738",
"term": "Signaling by FGFR2",
"cat": 13
},
{
"id": "R-HSA-5654741",
"term": "Signaling by FGFR3",
"cat": 13
},
{
"id": "R-HSA-5654743",
"term": "Signaling by FGFR4",
"cat": 13
},
{
"id": "R-HSA-5655253",
"term": "Signaling by FGFR2 in disease",
"cat": 13
},
{
"id": "R-HSA-5655332",
"term": "Signaling by FGFR3 in disease",
"cat": 13
},
{
"id": "R-HSA-5673001",
"term": "RAF/MAP kinase cascade",
"cat": 13
},
{
"id": "R-HSA-74751",
"term": "Insulin receptor signalling cascade",
"cat": 13
},
{
"id": "R-HSA-1839126",
"term": "FGFR2 mutant receptor activation",
"cat": 14
},
{
"id": "R-HSA-190239",
"term": "FGFR3 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-190241",
"term": "FGFR2 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-190322",
"term": "FGFR4 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-2033514",
"term": "FGFR3 mutant receptor activation",
"cat": 14
},
{
"id": "R-HSA-2428928",
"term": "IRS-related events triggered by IGF1R",
"cat": 14
},
{
"id": "R-HSA-5654696",
"term": "Downstream signaling of activated FGFR2",
"cat": 14
},
{
"id": "R-HSA-5654708",
"term": "Downstream signaling of activated FGFR3",
"cat": 14
},
{
"id": "R-HSA-5654716",
"term": "Downstream signaling of activated FGFR4",
"cat": 14
},
{
"id": "R-HSA-5654727",
"term": "Negative regulation of FGFR2 signaling",
"cat": 14
},
{
"id": "R-HSA-5654732",
"term": "Negative regulation of FGFR3 signaling",
"cat": 14
},
{
"id": "R-HSA-5654733",
"term": "Negative regulation of FGFR4 signaling",
"cat": 14
},
{
"id": "R-HSA-6811558",
"term": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling",
"cat": 14
},
{
"id": "R-HSA-112399",
"term": "IRS-mediated signalling",
"cat": 15
},
{
"id": "R-HSA-1839130",
"term": "Signaling by activated point mutants of FGFR3",
"cat": 15
},
{
"id": "R-HSA-190372",
"term": "FGFR3c ligand binding and activation",
"cat": 15
},
{
"id": "R-HSA-190375",
"term": "FGFR2c ligand binding and activation",
"cat": 15
},
{
"id": "R-HSA-2033519",
"term": "Activated point mutants of FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654221",
"term": "Phospholipase C-mediated cascade; FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654227",
"term": "Phospholipase C-mediated cascade; FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654228",
"term": "Phospholipase C-mediated cascade; FGFR4",
"cat": 15
},
{
"id": "R-HSA-5654695",
"term": "PI-3K cascade:FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654699",
"term": "SHC-mediated cascade:FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654700",
"term": "FRS-mediated FGFR2 signaling",
"cat": 15
},
{
"id": "R-HSA-5654704",
"term": "SHC-mediated cascade:FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654706",
"term": "FRS-mediated FGFR3 signaling",
"cat": 15
},
{
"id": "R-HSA-5654710",
"term": "PI-3K cascade:FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654712",
"term": "FRS-mediated FGFR4 signaling",
"cat": 15
},
{
"id": "R-HSA-5654719",
"term": "SHC-mediated cascade:FGFR4",
"cat": 15
},
{
"id": "R-HSA-5654720",
"term": "PI-3K cascade:FGFR4",
"cat": 15
},
{
"id": "R-HSA-109704",
"term": "PI3K Cascade",
"cat": 16
},
{
"id": "GO:0005104",
"term": "fibroblast growth factor receptor binding",
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
32296183
],
"cat": 0
},
{
"id": "GO:0008083",
"term": "growth factor activity",
"cat": 0
},
{
"id": "GO:0001936",
"term": "regulation of endothelial cell proliferation",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0007165",
"term": "signal transduction",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0007267",
"term": "cell-cell signaling",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0008284",
"term": "positive regulation of cell population proliferation",
"cat": 1
},
{
"id": "GO:0008543",
"term": "fibroblast growth factor receptor signaling pathway",
"cat": 1
},
{
"id": "GO:0009266",
"term": "response to temperature stimulus",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0022008",
"term": "neurogenesis",
"cat": 1
},
{
"id": "GO:0030334",
"term": "regulation of cell migration",
"cat": 1
},
{
"id": "GO:0043405",
"term": "regulation of MAP kinase activity",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0043410",
"term": "positive regulation of MAPK cascade",
"cat": 1
},
{
"id": "GO:1903670",
"term": "regulation of sprouting angiogenesis",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:2000546",
"term": "positive regulation of endothelial cell chemotaxis to fibroblast growth factor",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
}
],
"protein": [
{
"symbol": "FGF16_HUMAN",
"name": "Fibroblast growth factor 16",
"accession": [
"O43320"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"MIM": [
"309630",
"300827",
"309630"
],
"EMBL": [
"AB009391",
"BX682239"
],
"CCDS": [
"CCDS75996.1"
],
"PIR": [
"JC5941"
],
"RefSeq": [
"NP_003859.1"
],
"AlphaFoldDB": [
"O43320"
],
"SMR": [
"O43320"
],
"BioGRID": [
"114350"
],
"IntAct": [
"O43320"
],
"STRING": [
"9606.ENSP00000399324"
],
"GlyCosmos": [
"O43320"
],
"GlyGen": [
"O43320"
],
"iPTMnet": [
"O43320"
],
"PhosphoSitePlus": [
"O43320"
],
"BioMuta": [
"FGF16"
],
"MassIVE": [
"O43320"
],
"PaxDb": [
"9606-ENSP00000399324"
],
"PeptideAtlas": [
"O43320"
],
"Antibodypedia": [
"72310"
],
"DNASU": [
"8823"
],
"Ensembl": [
"ENST00000439435.3"
],
"KEGG": [
"hsa:8823"
],
"MANE-Select": [
"ENST00000439435.3"
],
"UCSC": [
"uc033ejs.2"
],
"AGR": [
"HGNC:3672"
],
"CTD": [
"8823"
],
"DisGeNET": [
"8823"
],
"GeneCards": [
"FGF16"
],
"HGNC": [
"HGNC:3672"
],
"HPA": [
"ENSG00000196468"
],
"MalaCards": [
"FGF16"
],
"neXtProt": [
"NX_O43320"
],
"OpenTargets": [
"ENSG00000196468"
],
"Orphanet": [
"2498"
],
"PharmGKB": [
"PA28111"
],
"VEuPathDB": [
"HostDB:ENSG00000196468"
],
"eggNOG": [
"KOG3885"
],
"GeneTree": [
"ENSGT00940000160087"
],
"HOGENOM": [
"CLU_081609_0_0_1"
],
"InParanoid": [
"O43320"
],
"OMA": [
"MDSERHY"
],
"OrthoDB": [
"2883843at2759"
],
"PhylomeDB": [
"O43320"
],
"PathwayCommons": [
"O43320"
],
"Reactome": [
"R-HSA-109704",
"R-HSA-1257604",
"R-HSA-1839130",
"R-HSA-190322",
"R-HSA-190372",
"R-HSA-190375",
"R-HSA-2033519",
"R-HSA-2219530",
"R-HSA-5654221",
"R-HSA-5654227",
"R-HSA-5654228",
"R-HSA-5654695",
"R-HSA-5654699",
"R-HSA-5654700",
"R-HSA-5654704",
"R-HSA-5654706",
"R-HSA-5654710",
"R-HSA-5654712",
"R-HSA-5654719",
"R-HSA-5654720",
"R-HSA-5654727",
"R-HSA-5654732",
"R-HSA-5654733",
"R-HSA-5655253",
"R-HSA-5655332",
"R-HSA-5673001",
"R-HSA-6811558"
],
"SignaLink": [
"O43320"
],
"BioGRID-ORCS": [
"8823"
],
"GenomeRNAi": [
"8823"
],
"Pharos": [
"O43320"
],
"PRO": [
"PR:O43320"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"O43320"
],
"Bgee": [
"ENSG00000196468"
],
"GO": [
"GO:0005737",
"GO:0005576",
"GO:0005615",
"GO:0005104",
"GO:0008083",
"GO:0009887",
"GO:0030154",
"GO:0007267",
"GO:0008543",
"GO:0008284",
"GO:2000546",
"GO:0010628",
"GO:0043410",
"GO:0001934",
"GO:0030334",
"GO:0009266",
"GO:0007165"
],
"CDD": [
"cd00058"
],
"Gene3D": [
"2.80.10.50"
],
"InterPro": [
"IPR002209",
"IPR008996"
],
"PANTHER": [
"PTHR11486",
"PTHR11486:SF27"
],
"Pfam": [
"PF00167"
],
"PRINTS": [
"PR00263",
"PR00262"
],
"SMART": [
"SM00442"
],
"SUPFAM": [
"SSF50353"
],
"PROSITE": [
"PS00247"
]
},
"citations": [
{
"title": "Structure and expression of a novel member, FGF-16, on the fibroblast growth factor family.",
"pubmedID": "9473496",
"doi": "10.1006/bbrc.1998.8073"
},
{
"title": "The DNA sequence of the human X chromosome.",
"pubmedID": "15772651",
"doi": "10.1038/nature03440"
},
{
"title": "Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.",
"pubmedID": "16597617",
"doi": "10.1074/jbc.m601252200"
},
{
"title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.",
"pubmedID": "19690332",
"doi": "10.1126/scisignal.2000007"
},
{
"title": "Fibroblast growth factor signalling: from development to cancer.",
"pubmedID": "20094046",
"doi": "10.1038/nrc2780"
},
{
"title": "Whole exome sequencing identifies FGF16 nonsense mutations as the cause of X-linked recessive metacarpal 4/5 fusion.",
"pubmedID": "23709756",
"doi": "10.1136/jmedgenet-2013-101659"
},
{
"title": "Identification of three novel FGF16 mutations in X-linked recessive fusion of the fourth and fifth metacarpals and possible correlation with heart disease.",
"pubmedID": "25333065",
"doi": "10.1002/mgg3.81"
}
],
"sequence": {
"length": 207,
"mass": 23759,
"checksum": "D8AD160BDABDB5F8",
"modified": {
"$date": {
"$numberLong": "896659200000"
}
},
"version": 1,
"sequence": "MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR"
},
"existence": 0,
"relevance": 1,
"proteinID": 3630113647
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}