Details Currently Unavailable
A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.
AI-Generated Summary
Disclaimer: This summary is AI-generated based on limited data and may be speculative or contain inaccuracies. Detailed expression analysis for this entry is unavailable.
Raw Database JSON for Gene ID: 9103
{
"geneID": 9103,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC243971.2"
]
},
"genePos": {
"start": 5001,
"end": 24882
},
"orientation": true,
"symbol": "FCGR2C",
"created": {
"$date": {
"$numberLong": "1738333349794"
}
},
"crossReference": {
"bulk": [
{
"dbName": "MIM",
"value": "612169"
}
]
},
"chrom": {
"pos": "1",
"type": 1,
"loc": "1q23.3"
},
"desc": "Fc gamma receptor IIc (gene/pseudogene)",
"geneType": 5,
"ontology": [
{
"id": "GO:0004888",
"term": "transmembrane signaling receptor activity",
"pubMed": [
2531080
],
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
17474147,
17785206
],
"cat": 0
},
{
"id": "GO:0019770",
"term": "IgG receptor activity",
"cat": 0
},
{
"id": "GO:0019864",
"term": "IgG binding",
"cat": 0
},
{
"id": "GO:0001788",
"term": "antibody-dependent cellular cytotoxicity",
"cat": 1
},
{
"id": "GO:0006955",
"term": "immune response",
"pubMed": [
2531080
],
"cat": 1
},
{
"id": "GO:0007166",
"term": "cell surface receptor signaling pathway",
"cat": 1
},
{
"id": "GO:0032760",
"term": "positive regulation of tumor necrosis factor production",
"cat": 1
},
{
"id": "GO:0038094",
"term": "Fc-gamma receptor signaling pathway",
"cat": 1
},
{
"id": "GO:0050766",
"term": "positive regulation of phagocytosis",
"cat": 1
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
},
{
"id": "GO:0009897",
"term": "external side of plasma membrane",
"cat": 2
},
{
"id": "GO:0016020",
"term": "membrane",
"pubMed": [
2531080
],
"cat": 2
}
],
"protein": [
{
"symbol": "FCG2C_HUMAN",
"name": "Low affinity immunoglobulin gamma Fc region receptor II-c",
"accession": [
"P31995",
"O00523",
"O00524",
"O00525"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"X17652",
"X17652",
"U90938",
"U90939",
"U90940",
"U90941"
],
"PIR": [
"S06946"
],
"RefSeq": [
"NP_963857.3",
"XP_011507594.1"
],
"PDB": [
"3WJL",
"6YAX"
],
"PDBsum": [
"3WJL",
"6YAX"
],
"AlphaFoldDB": [
"P31995"
],
"SMR": [
"P31995"
],
"BioGRID": [
"114556"
],
"IntAct": [
"P31995"
],
"DrugBank": [
"DB00087",
"DB00112",
"DB00111",
"DB00005",
"DB00028"
],
"GlyCosmos": [
"P31995"
],
"GlyGen": [
"P31995"
],
"iPTMnet": [
"P31995"
],
"PhosphoSitePlus": [
"P31995"
],
"BioMuta": [
"FCGR2C"
],
"DMDM": [
"399478"
],
"jPOST": [
"P31995"
],
"MassIVE": [
"P31995"
],
"PeptideAtlas": [
"P31995"
],
"ProteomicsDB": [
"54825",
"54826",
"54827",
"54828"
],
"Pumba": [
"P31995"
],
"TopDownProteomics": [
"P31995-4"
],
"DNASU": [
"9103"
],
"KEGG": [
"hsa:9103"
],
"AGR": [
"HGNC:15626"
],
"CTD": [
"9103"
],
"DisGeNET": [
"9103"
],
"GeneCards": [
"FCGR2C"
],
"HGNC": [
"HGNC:15626"
],
"MalaCards": [
"FCGR2C"
],
"MIM": [
"612169"
],
"neXtProt": [
"NX_P31995"
],
"Orphanet": [
"3002"
],
"InParanoid": [
"P31995"
],
"PhylomeDB": [
"P31995"
],
"PathwayCommons": [
"P31995"
],
"SignaLink": [
"P31995"
],
"SIGNOR": [
"P31995"
],
"BioGRID-ORCS": [
"2213",
"9103"
],
"EvolutionaryTrace": [
"P31995"
],
"Pharos": [
"P31995"
],
"PRO": [
"PR:P31995"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P31995"
],
"GO": [
"GO:0005737",
"GO:0009897",
"GO:0016020",
"GO:0019864",
"GO:0019770",
"GO:0004888",
"GO:0001788",
"GO:0007166",
"GO:0006955",
"GO:0050766",
"GO:0032760"
],
"CDD": [
"cd05752",
"cd05753"
],
"Gene3D": [
"2.60.40.10"
],
"InterPro": [
"IPR007110",
"IPR036179",
"IPR013783",
"IPR050488",
"IPR003599",
"IPR003598"
],
"PANTHER": [
"PTHR11481",
"PTHR11481:SF97"
],
"Pfam": [
"PF13895"
],
"SMART": [
"SM00409",
"SM00408"
],
"SUPFAM": [
"SSF48726"
],
"PROSITE": [
"PS50835"
]
},
"citations": [
{
"title": "Human IgG Fc receptor (hFcRII; CD32) exists as multiple isoforms in macrophages, lymphocytes and IgG-transporting placental epithelium.",
"pubmedID": "2531080",
"doi": "10.1002/j.1460-2075.1989.tb08540.x"
},
{
"title": "Expression of functional CD32 molecules on human NK cells is determined by an allelic polymorphism of the FcgammaRIIC gene.",
"pubmedID": "9516136"
},
{
"title": "In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation.",
"pubmedID": "8756631",
"doi": "10.1128/mcb.16.9.4735"
},
{
"title": "Engineered antibody Fc variant with selectively enhanced FcgammaRIIb binding over both FcgammaRIIa(R131) and FcgammaRIIa(H131).",
"pubmedID": "23744091",
"doi": "10.1093/protein/gzt022"
}
],
"sequence": {
"length": 323,
"mass": 35578,
"checksum": "DC4C1A22A0DE4572",
"modified": {
"$date": {
"$numberLong": "741484800000"
}
},
"version": 1,
"sequence": "MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN"
},
"existence": 0,
"relevance": 1,
"proteinID": 2504388969
}
]
}