Details Currently Unavailable

A detailed, interactive page could not be generated for the requested gene. This usually happens when there is no significant expression data (CSI) available for it in our database.


AI-Generated Summary

Array

Raw Database JSON for Gene ID: 9103

{
    "geneID": 9103,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC243971.2"
        ]
    },
    "genePos": {
        "start": 5001,
        "end": 24882
    },
    "orientation": true,
    "symbol": "FCGR2C",
    "created": {
        "$date": {
            "$numberLong": "1738333349794"
        }
    },
    "crossReference": {
        "bulk": [
            {
                "dbName": "MIM",
                "value": "612169"
            }
        ]
    },
    "chrom": {
        "pos": "1",
        "type": 1,
        "loc": "1q23.3"
    },
    "desc": "Fc gamma receptor IIc (gene/pseudogene)",
    "geneType": 5,
    "ontology": [
        {
            "id": "GO:0004888",
            "term": "transmembrane signaling receptor activity",
            "pubMed": [
                2531080
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                17474147,
                17785206
            ],
            "cat": 0
        },
        {
            "id": "GO:0019770",
            "term": "IgG receptor activity",
            "cat": 0
        },
        {
            "id": "GO:0019864",
            "term": "IgG binding",
            "cat": 0
        },
        {
            "id": "GO:0001788",
            "term": "antibody-dependent cellular cytotoxicity",
            "cat": 1
        },
        {
            "id": "GO:0006955",
            "term": "immune response",
            "pubMed": [
                2531080
            ],
            "cat": 1
        },
        {
            "id": "GO:0007166",
            "term": "cell surface receptor signaling pathway",
            "cat": 1
        },
        {
            "id": "GO:0032760",
            "term": "positive regulation of tumor necrosis factor production",
            "cat": 1
        },
        {
            "id": "GO:0038094",
            "term": "Fc-gamma receptor signaling pathway",
            "cat": 1
        },
        {
            "id": "GO:0050766",
            "term": "positive regulation of phagocytosis",
            "cat": 1
        },
        {
            "id": "GO:0005737",
            "term": "cytoplasm",
            "cat": 2
        },
        {
            "id": "GO:0009897",
            "term": "external side of plasma membrane",
            "cat": 2
        },
        {
            "id": "GO:0016020",
            "term": "membrane",
            "pubMed": [
                2531080
            ],
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "FCG2C_HUMAN",
            "name": "Low affinity immunoglobulin gamma Fc region receptor II-c",
            "accession": [
                "P31995",
                "O00523",
                "O00524",
                "O00525"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "EMBL": [
                    "X17652",
                    "X17652",
                    "U90938",
                    "U90939",
                    "U90940",
                    "U90941"
                ],
                "PIR": [
                    "S06946"
                ],
                "RefSeq": [
                    "NP_963857.3",
                    "XP_011507594.1"
                ],
                "PDB": [
                    "3WJL",
                    "6YAX"
                ],
                "PDBsum": [
                    "3WJL",
                    "6YAX"
                ],
                "AlphaFoldDB": [
                    "P31995"
                ],
                "SMR": [
                    "P31995"
                ],
                "BioGRID": [
                    "114556"
                ],
                "IntAct": [
                    "P31995"
                ],
                "DrugBank": [
                    "DB00087",
                    "DB00112",
                    "DB00111",
                    "DB00005",
                    "DB00028"
                ],
                "GlyCosmos": [
                    "P31995"
                ],
                "GlyGen": [
                    "P31995"
                ],
                "iPTMnet": [
                    "P31995"
                ],
                "PhosphoSitePlus": [
                    "P31995"
                ],
                "BioMuta": [
                    "FCGR2C"
                ],
                "DMDM": [
                    "399478"
                ],
                "jPOST": [
                    "P31995"
                ],
                "MassIVE": [
                    "P31995"
                ],
                "PeptideAtlas": [
                    "P31995"
                ],
                "ProteomicsDB": [
                    "54825",
                    "54826",
                    "54827",
                    "54828"
                ],
                "Pumba": [
                    "P31995"
                ],
                "TopDownProteomics": [
                    "P31995-4"
                ],
                "DNASU": [
                    "9103"
                ],
                "KEGG": [
                    "hsa:9103"
                ],
                "AGR": [
                    "HGNC:15626"
                ],
                "CTD": [
                    "9103"
                ],
                "DisGeNET": [
                    "9103"
                ],
                "GeneCards": [
                    "FCGR2C"
                ],
                "HGNC": [
                    "HGNC:15626"
                ],
                "MalaCards": [
                    "FCGR2C"
                ],
                "MIM": [
                    "612169"
                ],
                "neXtProt": [
                    "NX_P31995"
                ],
                "Orphanet": [
                    "3002"
                ],
                "InParanoid": [
                    "P31995"
                ],
                "PhylomeDB": [
                    "P31995"
                ],
                "PathwayCommons": [
                    "P31995"
                ],
                "SignaLink": [
                    "P31995"
                ],
                "SIGNOR": [
                    "P31995"
                ],
                "BioGRID-ORCS": [
                    "2213",
                    "9103"
                ],
                "EvolutionaryTrace": [
                    "P31995"
                ],
                "Pharos": [
                    "P31995"
                ],
                "PRO": [
                    "PR:P31995"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P31995"
                ],
                "GO": [
                    "GO:0005737",
                    "GO:0009897",
                    "GO:0016020",
                    "GO:0019864",
                    "GO:0019770",
                    "GO:0004888",
                    "GO:0001788",
                    "GO:0007166",
                    "GO:0006955",
                    "GO:0050766",
                    "GO:0032760"
                ],
                "CDD": [
                    "cd05752",
                    "cd05753"
                ],
                "Gene3D": [
                    "2.60.40.10"
                ],
                "InterPro": [
                    "IPR007110",
                    "IPR036179",
                    "IPR013783",
                    "IPR050488",
                    "IPR003599",
                    "IPR003598"
                ],
                "PANTHER": [
                    "PTHR11481",
                    "PTHR11481:SF97"
                ],
                "Pfam": [
                    "PF13895"
                ],
                "SMART": [
                    "SM00409",
                    "SM00408"
                ],
                "SUPFAM": [
                    "SSF48726"
                ],
                "PROSITE": [
                    "PS50835"
                ]
            },
            "citations": [
                {
                    "title": "Human IgG Fc receptor (hFcRII; CD32) exists as multiple isoforms in macrophages, lymphocytes and IgG-transporting placental epithelium.",
                    "pubmedID": "2531080",
                    "doi": "10.1002/j.1460-2075.1989.tb08540.x"
                },
                {
                    "title": "Expression of functional CD32 molecules on human NK cells is determined by an allelic polymorphism of the FcgammaRIIC gene.",
                    "pubmedID": "9516136"
                },
                {
                    "title": "In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation.",
                    "pubmedID": "8756631",
                    "doi": "10.1128/mcb.16.9.4735"
                },
                {
                    "title": "Engineered antibody Fc variant with selectively enhanced FcgammaRIIb binding over both FcgammaRIIa(R131) and FcgammaRIIa(H131).",
                    "pubmedID": "23744091",
                    "doi": "10.1093/protein/gzt022"
                }
            ],
            "sequence": {
                "length": 323,
                "mass": 35578,
                "checksum": "DC4C1A22A0DE4572",
                "modified": {
                    "$date": {
                        "$numberLong": "741484800000"
                    }
                },
                "version": 1,
                "sequence": "MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 2504388969
        }
    ]
}