No CSI details found for gene ID: 8823
Other Information
This section provides additional information about the gene, including a description generated by an AI language model and details about associated proteins.
To protect our computational resources, the in-silico analysis is available exclusively for registered users.
Genular Protein ID: 3630113647
Symbol: FGF16_HUMAN
Name: Fibroblast growth factor 16
UniProtKB Accession Codes:
Database IDs:
Citations:
PubMed ID: 9473496
Title: Structure and expression of a novel member, FGF-16, on the fibroblast growth factor family.
PubMed ID: 9473496
PubMed ID: 15772651
PubMed ID: 16597617
Title: Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
PubMed ID: 16597617
PubMed ID: 19690332
Title: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
PubMed ID: 19690332
PubMed ID: 20094046
Title: Fibroblast growth factor signalling: from development to cancer.
PubMed ID: 20094046
DOI: 10.1038/nrc2780
PubMed ID: 23709756
Title: Whole exome sequencing identifies FGF16 nonsense mutations as the cause of X-linked recessive metacarpal 4/5 fusion.
PubMed ID: 23709756
PubMed ID: 25333065
Title: Identification of three novel FGF16 mutations in X-linked recessive fusion of the fourth and fifth metacarpals and possible correlation with heart disease.
PubMed ID: 25333065
DOI: 10.1002/mgg3.81
Sequence Information:
- Length: 207
- Mass: 23759
- Checksum: D8AD160BDABDB5F8
- Sequence:
MAEVGGVFAS LDWDLHGFSS SLGNVPLADS PGFLNERLGQ IEGKLQRGSP TDFAHLKGIL RRRQLYCRTG FHLEIFPNGT VHGTRHDHSR FGILEFISLA VGLISIRGVD SGLYLGMNER GELYGSKKLT RECVFREQFE ENWYNTYAST LYKHSDSERQ YYVALNKDGS PREGYRTKRH QKFTHFLPRP VDPSKLPSMS RDLFHYR
Details Unavailable
Detailed CSI data for this gene is not available. You will be redirected to a page with all available raw data in 3 seconds.
If you are not redirected automatically, please click here.
{
"geneID": 8823,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AC243316.3"
]
},
"genePos": {
"start": 4715,
"end": 14604
},
"orientation": false,
"symbol": "FGF16",
"created": {
"$date": {
"$numberLong": "1738333349598"
}
},
"crossReference": {
"enseGeneID": "ENSG00000196468",
"enseRnaID": [
"ENST00000439435.3"
],
"enseProtID": [
"ENSP00000399324.2"
]
},
"chrom": {
"loc": "Xq21.1"
},
"desc": "fibroblast growth factor 16",
"geneType": 5,
"mim": [
{
"id": 300827,
"relation": 0
},
{
"id": 309630,
"relation": 1,
"cui": 1839728
}
],
"ontology": [
{
"id": "R-HSA-162582",
"term": "Signal Transduction",
"cat": 10
},
{
"id": "R-HSA-1643685",
"term": "Disease",
"cat": 10
},
{
"id": "R-HSA-5663202",
"term": "Diseases of signal transduction by growth factor receptors and second messengers",
"cat": 11
},
{
"id": "R-HSA-5683057",
"term": "MAPK family signaling cascades",
"cat": 11
},
{
"id": "R-HSA-9006925",
"term": "Intracellular signaling by second messengers",
"cat": 11
},
{
"id": "R-HSA-9006934",
"term": "Signaling by Receptor Tyrosine Kinases",
"cat": 11
},
{
"id": "R-HSA-1226099",
"term": "Signaling by FGFR in disease",
"cat": 12
},
{
"id": "R-HSA-1257604",
"term": "PIP3 activates AKT signaling",
"cat": 12
},
{
"id": "R-HSA-190236",
"term": "Signaling by FGFR",
"cat": 12
},
{
"id": "R-HSA-2219528",
"term": "PI3K\/AKT Signaling in Cancer",
"cat": 12
},
{
"id": "R-HSA-2404192",
"term": "Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)",
"cat": 12
},
{
"id": "R-HSA-5684996",
"term": "MAPK1\/MAPK3 signaling",
"cat": 12
},
{
"id": "R-HSA-74752",
"term": "Signaling by Insulin receptor",
"cat": 12
},
{
"id": "R-HSA-199418",
"term": "Negative regulation of the PI3K\/AKT network",
"cat": 13
},
{
"id": "R-HSA-2219530",
"term": "Constitutive Signaling by Aberrant PI3K in Cancer",
"cat": 13
},
{
"id": "R-HSA-2428924",
"term": "IGF1R signaling cascade",
"cat": 13
},
{
"id": "R-HSA-5654738",
"term": "Signaling by FGFR2",
"cat": 13
},
{
"id": "R-HSA-5654741",
"term": "Signaling by FGFR3",
"cat": 13
},
{
"id": "R-HSA-5654743",
"term": "Signaling by FGFR4",
"cat": 13
},
{
"id": "R-HSA-5655253",
"term": "Signaling by FGFR2 in disease",
"cat": 13
},
{
"id": "R-HSA-5655332",
"term": "Signaling by FGFR3 in disease",
"cat": 13
},
{
"id": "R-HSA-5673001",
"term": "RAF\/MAP kinase cascade",
"cat": 13
},
{
"id": "R-HSA-74751",
"term": "Insulin receptor signalling cascade",
"cat": 13
},
{
"id": "R-HSA-1839126",
"term": "FGFR2 mutant receptor activation",
"cat": 14
},
{
"id": "R-HSA-190239",
"term": "FGFR3 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-190241",
"term": "FGFR2 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-190322",
"term": "FGFR4 ligand binding and activation",
"cat": 14
},
{
"id": "R-HSA-2033514",
"term": "FGFR3 mutant receptor activation",
"cat": 14
},
{
"id": "R-HSA-2428928",
"term": "IRS-related events triggered by IGF1R",
"cat": 14
},
{
"id": "R-HSA-5654696",
"term": "Downstream signaling of activated FGFR2",
"cat": 14
},
{
"id": "R-HSA-5654708",
"term": "Downstream signaling of activated FGFR3",
"cat": 14
},
{
"id": "R-HSA-5654716",
"term": "Downstream signaling of activated FGFR4",
"cat": 14
},
{
"id": "R-HSA-5654727",
"term": "Negative regulation of FGFR2 signaling",
"cat": 14
},
{
"id": "R-HSA-5654732",
"term": "Negative regulation of FGFR3 signaling",
"cat": 14
},
{
"id": "R-HSA-5654733",
"term": "Negative regulation of FGFR4 signaling",
"cat": 14
},
{
"id": "R-HSA-6811558",
"term": "PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling",
"cat": 14
},
{
"id": "R-HSA-112399",
"term": "IRS-mediated signalling",
"cat": 15
},
{
"id": "R-HSA-1839130",
"term": "Signaling by activated point mutants of FGFR3",
"cat": 15
},
{
"id": "R-HSA-190372",
"term": "FGFR3c ligand binding and activation",
"cat": 15
},
{
"id": "R-HSA-190375",
"term": "FGFR2c ligand binding and activation",
"cat": 15
},
{
"id": "R-HSA-2033519",
"term": "Activated point mutants of FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654221",
"term": "Phospholipase C-mediated cascade; FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654227",
"term": "Phospholipase C-mediated cascade; FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654228",
"term": "Phospholipase C-mediated cascade; FGFR4",
"cat": 15
},
{
"id": "R-HSA-5654695",
"term": "PI-3K cascade:FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654699",
"term": "SHC-mediated cascade:FGFR2",
"cat": 15
},
{
"id": "R-HSA-5654700",
"term": "FRS-mediated FGFR2 signaling",
"cat": 15
},
{
"id": "R-HSA-5654704",
"term": "SHC-mediated cascade:FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654706",
"term": "FRS-mediated FGFR3 signaling",
"cat": 15
},
{
"id": "R-HSA-5654710",
"term": "PI-3K cascade:FGFR3",
"cat": 15
},
{
"id": "R-HSA-5654712",
"term": "FRS-mediated FGFR4 signaling",
"cat": 15
},
{
"id": "R-HSA-5654719",
"term": "SHC-mediated cascade:FGFR4",
"cat": 15
},
{
"id": "R-HSA-5654720",
"term": "PI-3K cascade:FGFR4",
"cat": 15
},
{
"id": "R-HSA-109704",
"term": "PI3K Cascade",
"cat": 16
},
{
"id": "GO:0005104",
"term": "fibroblast growth factor receptor binding",
"cat": 0
},
{
"id": "GO:0005515",
"term": "protein binding",
"pubMed": [
32296183
],
"cat": 0
},
{
"id": "GO:0008083",
"term": "growth factor activity",
"cat": 0
},
{
"id": "GO:0001936",
"term": "regulation of endothelial cell proliferation",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0007165",
"term": "signal transduction",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0007267",
"term": "cell-cell signaling",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0008284",
"term": "positive regulation of cell population proliferation",
"cat": 1
},
{
"id": "GO:0008543",
"term": "fibroblast growth factor receptor signaling pathway",
"cat": 1
},
{
"id": "GO:0009266",
"term": "response to temperature stimulus",
"pubMed": [
9473496
],
"cat": 1
},
{
"id": "GO:0022008",
"term": "neurogenesis",
"cat": 1
},
{
"id": "GO:0030334",
"term": "regulation of cell migration",
"cat": 1
},
{
"id": "GO:0043405",
"term": "regulation of MAP kinase activity",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0043410",
"term": "positive regulation of MAPK cascade",
"cat": 1
},
{
"id": "GO:1903670",
"term": "regulation of sprouting angiogenesis",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:2000546",
"term": "positive regulation of endothelial cell chemotaxis to fibroblast growth factor",
"pubMed": [
16756958
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"cat": 2
},
{
"id": "GO:0005737",
"term": "cytoplasm",
"cat": 2
}
],
"protein": [
{
"symbol": "FGF16_HUMAN",
"name": "Fibroblast growth factor 16",
"accession": [
"O43320"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"MIM": [
"309630",
"300827",
"309630"
],
"EMBL": [
"AB009391",
"BX682239"
],
"CCDS": [
"CCDS75996.1"
],
"PIR": [
"JC5941"
],
"RefSeq": [
"NP_003859.1"
],
"AlphaFoldDB": [
"O43320"
],
"SMR": [
"O43320"
],
"BioGRID": [
"114350"
],
"IntAct": [
"O43320"
],
"STRING": [
"9606.ENSP00000399324"
],
"GlyCosmos": [
"O43320"
],
"GlyGen": [
"O43320"
],
"iPTMnet": [
"O43320"
],
"PhosphoSitePlus": [
"O43320"
],
"BioMuta": [
"FGF16"
],
"MassIVE": [
"O43320"
],
"PaxDb": [
"9606-ENSP00000399324"
],
"PeptideAtlas": [
"O43320"
],
"Antibodypedia": [
"72310"
],
"DNASU": [
"8823"
],
"Ensembl": [
"ENST00000439435.3"
],
"KEGG": [
"hsa:8823"
],
"MANE-Select": [
"ENST00000439435.3"
],
"UCSC": [
"uc033ejs.2"
],
"AGR": [
"HGNC:3672"
],
"CTD": [
"8823"
],
"DisGeNET": [
"8823"
],
"GeneCards": [
"FGF16"
],
"HGNC": [
"HGNC:3672"
],
"HPA": [
"ENSG00000196468"
],
"MalaCards": [
"FGF16"
],
"neXtProt": [
"NX_O43320"
],
"OpenTargets": [
"ENSG00000196468"
],
"Orphanet": [
"2498"
],
"PharmGKB": [
"PA28111"
],
"VEuPathDB": [
"HostDB:ENSG00000196468"
],
"eggNOG": [
"KOG3885"
],
"GeneTree": [
"ENSGT00940000160087"
],
"HOGENOM": [
"CLU_081609_0_0_1"
],
"InParanoid": [
"O43320"
],
"OMA": [
"MDSERHY"
],
"OrthoDB": [
"2883843at2759"
],
"PhylomeDB": [
"O43320"
],
"PathwayCommons": [
"O43320"
],
"Reactome": [
"R-HSA-109704",
"R-HSA-1257604",
"R-HSA-1839130",
"R-HSA-190322",
"R-HSA-190372",
"R-HSA-190375",
"R-HSA-2033519",
"R-HSA-2219530",
"R-HSA-5654221",
"R-HSA-5654227",
"R-HSA-5654228",
"R-HSA-5654695",
"R-HSA-5654699",
"R-HSA-5654700",
"R-HSA-5654704",
"R-HSA-5654706",
"R-HSA-5654710",
"R-HSA-5654712",
"R-HSA-5654719",
"R-HSA-5654720",
"R-HSA-5654727",
"R-HSA-5654732",
"R-HSA-5654733",
"R-HSA-5655253",
"R-HSA-5655332",
"R-HSA-5673001",
"R-HSA-6811558"
],
"SignaLink": [
"O43320"
],
"BioGRID-ORCS": [
"8823"
],
"GenomeRNAi": [
"8823"
],
"Pharos": [
"O43320"
],
"PRO": [
"PR:O43320"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"O43320"
],
"Bgee": [
"ENSG00000196468"
],
"GO": [
"GO:0005737",
"GO:0005576",
"GO:0005615",
"GO:0005104",
"GO:0008083",
"GO:0009887",
"GO:0030154",
"GO:0007267",
"GO:0008543",
"GO:0008284",
"GO:2000546",
"GO:0010628",
"GO:0043410",
"GO:0001934",
"GO:0030334",
"GO:0009266",
"GO:0007165"
],
"CDD": [
"cd00058"
],
"Gene3D": [
"2.80.10.50"
],
"InterPro": [
"IPR002209",
"IPR008996"
],
"PANTHER": [
"PTHR11486",
"PTHR11486:SF27"
],
"Pfam": [
"PF00167"
],
"PRINTS": [
"PR00263",
"PR00262"
],
"SMART": [
"SM00442"
],
"SUPFAM": [
"SSF50353"
],
"PROSITE": [
"PS00247"
]
},
"citations": [
{
"title": "Structure and expression of a novel member, FGF-16, on the fibroblast growth factor family.",
"pubmedID": "9473496",
"doi": "10.1006\/bbrc.1998.8073"
},
{
"title": "The DNA sequence of the human X chromosome.",
"pubmedID": "15772651",
"doi": "10.1038\/nature03440"
},
{
"title": "Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.",
"pubmedID": "16597617",
"doi": "10.1074\/jbc.m601252200"
},
{
"title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.",
"pubmedID": "19690332",
"doi": "10.1126\/scisignal.2000007"
},
{
"title": "Fibroblast growth factor signalling: from development to cancer.",
"pubmedID": "20094046",
"doi": "10.1038\/nrc2780"
},
{
"title": "Whole exome sequencing identifies FGF16 nonsense mutations as the cause of X-linked recessive metacarpal 4\/5 fusion.",
"pubmedID": "23709756",
"doi": "10.1136\/jmedgenet-2013-101659"
},
{
"title": "Identification of three novel FGF16 mutations in X-linked recessive fusion of the fourth and fifth metacarpals and possible correlation with heart disease.",
"pubmedID": "25333065",
"doi": "10.1002\/mgg3.81"
}
],
"sequence": {
"length": 207,
"mass": 23759,
"checksum": "D8AD160BDABDB5F8",
"modified": {
"$date": {
"$numberLong": "896659200000"
}
},
"version": 1,
"sequence": "MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR"
},
"existence": 0,
"relevance": 1,
"proteinID": 3630113647
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}