No CSI details found for gene ID: 5741

Other Information

This section provides additional information about the gene, including a description generated by an AI language model and details about associated proteins.

Genular Protein ID: 3686908245

Symbol: PTHY_HUMAN

Name: Parathyroid hormone

UniProtKB Accession Codes:

Database IDs:

Citations:

PubMed ID: 6950381

Title: Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone.

PubMed ID: 6950381

DOI: 10.1073/pnas.78.12.7365

PubMed ID: 6220408

Title: Nucleotide sequence of the human parathyroid hormone gene.

PubMed ID: 6220408

DOI: 10.1073/pnas.80.8.2127

PubMed ID: 15489334

Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).

PubMed ID: 15489334

DOI: 10.1101/gr.2596504

PubMed ID: 7829495

Title: Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein.

PubMed ID: 7829495

DOI: 10.1074/jbc.270.4.1629

PubMed ID: 4833516

Title: Structural analysis of human proparathyroid hormone by a new microsequencing approach.

PubMed ID: 4833516

DOI: 10.1038/249155a0

PubMed ID: 15340161

Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites.

PubMed ID: 15340161

DOI: 10.1110/ps.04682504

PubMed ID: 4521809

Title: The amino-acid sequence of the amino-terminal 37 residues of human parathyroid hormone.

PubMed ID: 4521809

DOI: 10.1073/pnas.71.2.384

PubMed ID: 728431

Title: Complete amino acid sequence of human parathyroid hormone.

PubMed ID: 728431

DOI: 10.1021/bi00619a019

PubMed ID: 1125201

Title: A reinvestigation of the amino-terminal sequence of human parathyroid hormone.

PubMed ID: 1125201

DOI: 10.1021/bi00680a006

PubMed ID: 4474131

Title: Solid-phase synthesis of the biologically active N-terminal 1-34 peptide of human parathyroid hormone.

PubMed ID: 4474131

DOI: 10.1515/bchm2.1974.355.1.415

PubMed ID: 4721748

Title: Synthesis of sequence 1-34 of human parathyroid hormone.

PubMed ID: 4721748

DOI: 10.1002/hlca.19730560139

PubMed ID: 21076856

Title: Stimulation of glucose transport in osteoblastic cells by parathyroid hormone and insulin-like growth factor I.

PubMed ID: 21076856

DOI: 10.1007/s11010-010-0634-z

PubMed ID: 2069952

Title: Investigation of the solution structure of the human parathyroid hormone fragment (1-34) by 1H NMR spectroscopy, distance geometry, and molecular dynamics calculations.

PubMed ID: 2069952

DOI: 10.1021/bi00242a018

PubMed ID: 8344299

Title: Stabilized NMR structure of human parathyroid hormone(1-34).

PubMed ID: 8344299

DOI: 10.1111/j.1432-1033.1993.tb18037.x

PubMed ID: 7797503

Title: Structure of human parathyroid hormone 1-37 in solution.

PubMed ID: 7797503

DOI: 10.1074/jbc.270.25.15194

PubMed ID: 10623601

Title: Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37).

PubMed ID: 10623601

DOI: 10.1006/bbrc.1999.1958

PubMed ID: 10837469

Title: Crystal structure of human parathyroid hormone 1-34 at 0.9-A resolution.

PubMed ID: 10837469

DOI: 10.1074/jbc.m001134200

PubMed ID: 18375760

Title: Molecular recognition of parathyroid hormone by its G protein-coupled receptor.

PubMed ID: 18375760

DOI: 10.1073/pnas.0801027105

PubMed ID: 2212001

Title: Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism.

PubMed ID: 2212001

DOI: 10.1172/jci114811

PubMed ID: 10523031

Title: A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism.

PubMed ID: 10523031

DOI: 10.1210/jcem.84.10.6070

PubMed ID: 18056632

Title: Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone.

PubMed ID: 18056632

DOI: 10.1073/pnas.0708725104

Sequence Information:

  • Length: 115
  • Mass: 12861
  • Checksum: 849015736A6E5597
  • Sequence:
  • MIPAKDMAKV MIVMLAICFL TKSDGKSVKK RSVSEIQLMH NLGKHLNSME RVEWLRKKLQ 
    DVHNFVALGA PLAPRDAGSQ RPRKKEDNVL VESHEKSLGE ADKADVNVLT KAKSQ
 
                
                    {
    "geneID": 5741,
    "tax": {
        "id": 9606,
        "name": [
            {
                "name": "Homo sapiens Linnaeus 1758"
            },
            {
                "name": "Homo sapiens",
                "type": 0
            },
            {
                "name": "human",
                "type": 4
            }
        ]
    },
    "accession": {
        "gene": [
            "AC021269.4"
        ]
    },
    "genePos": {
        "start": 5024,
        "end": 8967
    },
    "orientation": false,
    "symbol": "PTH",
    "created": {
        "$date": {
            "$numberLong": "1738333349107"
        }
    },
    "crossReference": {
        "enseGeneID": "ENSG00000152266",
        "enseRnaID": [
            "ENST00000282091.6"
        ],
        "enseProtID": [
            "ENSP00000282091.1"
        ]
    },
    "chrom": {
        "pos": "11",
        "type": 1,
        "loc": "11p15.3"
    },
    "desc": "parathyroid hormone",
    "geneType": 5,
    "mim": [
        {
            "id": 168450,
            "relation": 0
        },
        {
            "id": 146200,
            "relation": 1,
            "cui": 5241444
        }
    ],
    "ontology": [
        {
            "id": "R-HSA-162582",
            "term": "Signal Transduction",
            "cat": 10
        },
        {
            "id": "R-HSA-372790",
            "term": "Signaling by GPCR",
            "cat": 11
        },
        {
            "id": "R-HSA-388396",
            "term": "GPCR downstream signalling",
            "cat": 12
        },
        {
            "id": "R-HSA-500792",
            "term": "GPCR ligand binding",
            "cat": 12
        },
        {
            "id": "R-HSA-373080",
            "term": "Class B\/2 (Secretin family receptors)",
            "cat": 13
        },
        {
            "id": "R-HSA-418555",
            "term": "G alpha (s) signalling events",
            "cat": 13
        },
        {
            "id": "GO:0005179",
            "term": "hormone activity",
            "cat": 0
        },
        {
            "id": "GO:0005179",
            "term": "hormone activity",
            "pubMed": [
                11604398
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                11604398
            ],
            "cat": 0
        },
        {
            "id": "GO:0005515",
            "term": "protein binding",
            "pubMed": [
                19674967,
                32296183
            ],
            "cat": 0
        },
        {
            "id": "GO:0031856",
            "term": "parathyroid hormone receptor binding",
            "cat": 0
        },
        {
            "id": "GO:0031857",
            "term": "type 1 parathyroid hormone receptor binding",
            "pubMed": [
                11604398
            ],
            "cat": 0
        },
        {
            "id": "GO:0048018",
            "term": "receptor ligand activity",
            "pubMed": [
                11604398
            ],
            "cat": 0
        },
        {
            "id": "GO:0051428",
            "term": "peptide hormone receptor binding",
            "pubMed": [
                19674967
            ],
            "cat": 0
        },
        {
            "id": "GO:0051428",
            "term": "peptide hormone receptor binding",
            "pubMed": [
                11604398
            ],
            "cat": 0
        },
        {
            "id": "GO:0001501",
            "term": "skeletal system development",
            "pubMed": [
                10913913
            ],
            "cat": 1
        },
        {
            "id": "GO:0006366",
            "term": "transcription by RNA polymerase II",
            "cat": 1
        },
        {
            "id": "GO:0006874",
            "term": "intracellular calcium ion homeostasis",
            "cat": 1
        },
        {
            "id": "GO:0007186",
            "term": "G protein-coupled receptor signaling pathway",
            "pubMed": [
                7797535
            ],
            "cat": 1
        },
        {
            "id": "GO:0007189",
            "term": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
            "cat": 1
        },
        {
            "id": "GO:0007189",
            "term": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
            "pubMed": [
                11604398
            ],
            "cat": 1
        },
        {
            "id": "GO:0007266",
            "term": "Rho protein signal transduction",
            "cat": 1
        },
        {
            "id": "GO:0007267",
            "term": "cell-cell signaling",
            "cat": 1
        },
        {
            "id": "GO:0008628",
            "term": "hormone-mediated apoptotic signaling pathway",
            "pubMed": [
                10913913
            ],
            "cat": 1
        },
        {
            "id": "GO:0009059",
            "term": "macromolecule biosynthetic process",
            "pubMed": [
                19723499
            ],
            "cat": 1
        },
        {
            "id": "GO:0009410",
            "term": "response to xenobiotic stimulus",
            "cat": 1
        },
        {
            "id": "GO:0009967",
            "term": "positive regulation of signal transduction",
            "cat": 1
        },
        {
            "id": "GO:0010288",
            "term": "response to lead ion",
            "cat": 1
        },
        {
            "id": "GO:0010468",
            "term": "regulation of gene expression",
            "cat": 1
        },
        {
            "id": "GO:0010628",
            "term": "positive regulation of gene expression",
            "cat": 1
        },
        {
            "id": "GO:0010629",
            "term": "negative regulation of gene expression",
            "pubMed": [
                17696759
            ],
            "cat": 1
        },
        {
            "id": "GO:0010960",
            "term": "magnesium ion homeostasis",
            "cat": 1
        },
        {
            "id": "GO:0030282",
            "term": "bone mineralization",
            "cat": 1
        },
        {
            "id": "GO:0030501",
            "term": "positive regulation of bone mineralization",
            "pubMed": [
                17696759
            ],
            "cat": 1
        },
        {
            "id": "GO:0032331",
            "term": "negative regulation of chondrocyte differentiation",
            "cat": 1
        },
        {
            "id": "GO:0033280",
            "term": "response to vitamin D",
            "cat": 1
        },
        {
            "id": "GO:0045453",
            "term": "bone resorption",
            "pubMed": [
                15080150
            ],
            "cat": 1
        },
        {
            "id": "GO:0045471",
            "term": "response to ethanol",
            "cat": 1
        },
        {
            "id": "GO:0045725",
            "term": "positive regulation of glycogen biosynthetic process",
            "pubMed": [
                21076856
            ],
            "cat": 1
        },
        {
            "id": "GO:0045944",
            "term": "positive regulation of transcription by RNA polymerase II",
            "pubMed": [
                19723499
            ],
            "cat": 1
        },
        {
            "id": "GO:0046058",
            "term": "cAMP metabolic process",
            "pubMed": [
                9927325
            ],
            "cat": 1
        },
        {
            "id": "GO:0046326",
            "term": "positive regulation of D-glucose import",
            "pubMed": [
                21076856
            ],
            "cat": 1
        },
        {
            "id": "GO:0046686",
            "term": "response to cadmium ion",
            "cat": 1
        },
        {
            "id": "GO:0048873",
            "term": "homeostasis of number of cells within a tissue",
            "cat": 1
        },
        {
            "id": "GO:0055062",
            "term": "phosphate ion homeostasis",
            "cat": 1
        },
        {
            "id": "GO:0060732",
            "term": "positive regulation of inositol phosphate biosynthetic process",
            "pubMed": [
                11604398
            ],
            "cat": 1
        },
        {
            "id": "GO:0071107",
            "term": "response to parathyroid hormone",
            "cat": 1
        },
        {
            "id": "GO:0071774",
            "term": "response to fibroblast growth factor",
            "cat": 1
        },
        {
            "id": "GO:0071864",
            "term": "positive regulation of cell proliferation in bone marrow",
            "cat": 1
        },
        {
            "id": "GO:0071866",
            "term": "negative regulation of apoptotic process in bone marrow cell",
            "cat": 1
        },
        {
            "id": "GO:0090290",
            "term": "positive regulation of osteoclast proliferation",
            "cat": 1
        },
        {
            "id": "GO:1900158",
            "term": "negative regulation of bone mineralization involved in bone maturation",
            "cat": 1
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "pubMed": [
                14718574
            ],
            "cat": 2
        },
        {
            "id": "GO:0005576",
            "term": "extracellular region",
            "cat": 2
        },
        {
            "id": "GO:0005615",
            "term": "extracellular space",
            "cat": 2
        }
    ],
    "protein": [
        {
            "symbol": "PTHY_HUMAN",
            "name": "Parathyroid hormone",
            "accession": [
                "P01270",
                "Q4VB48",
                "Q9UD38"
            ],
            "databaseIDs": {
                "NCBI Taxonomy": [
                    "9606"
                ],
                "MIM": [
                    "146200",
                    "146200",
                    "168450"
                ],
                "EMBL": [
                    "V00597",
                    "J00301",
                    "BC096142",
                    "BC096143",
                    "BC096144",
                    "BC096145"
                ],
                "CCDS": [
                    "CCDS7812.1"
                ],
                "PIR": [
                    "A19339"
                ],
                "RefSeq": [
                    "NP_000306.1"
                ],
                "PDB": [
                    "1BWX",
                    "1ET1",
                    "1FVY",
                    "1HPH",
                    "1HPY",
                    "1HTH",
                    "1ZWA",
                    "1ZWB",
                    "1ZWD",
                    "1ZWE",
                    "1ZWF",
                    "1ZWG",
                    "2L1X",
                    "3C4M",
                    "7VVK",
                    "7VVL",
                    "7VVM",
                    "7VVN",
                    "7VVO",
                    "7Y36",
                    "8FLQ",
                    "8HA0",
                    "8HAO",
                    "8T5F"
                ],
                "PDBsum": [
                    "1BWX",
                    "1ET1",
                    "1FVY",
                    "1HPH",
                    "1HPY",
                    "1HTH",
                    "1ZWA",
                    "1ZWB",
                    "1ZWD",
                    "1ZWE",
                    "1ZWF",
                    "1ZWG",
                    "2L1X",
                    "3C4M",
                    "7VVK",
                    "7VVL",
                    "7VVM",
                    "7VVN",
                    "7VVO",
                    "7Y36",
                    "8FLQ",
                    "8HA0",
                    "8HAO",
                    "8T5F"
                ],
                "AlphaFoldDB": [
                    "P01270"
                ],
                "BMRB": [
                    "P01270"
                ],
                "EMDB": [
                    "EMD-29283",
                    "EMD-32142",
                    "EMD-32143",
                    "EMD-32144",
                    "EMD-32145",
                    "EMD-32146",
                    "EMD-33590",
                    "EMD-34585",
                    "EMD-34598"
                ],
                "SMR": [
                    "P01270"
                ],
                "BioGRID": [
                    "111713"
                ],
                "CORUM": [
                    "P01270"
                ],
                "IntAct": [
                    "P01270"
                ],
                "STRING": [
                    "9606.ENSP00000433208"
                ],
                "BindingDB": [
                    "P01270"
                ],
                "DrugBank": [
                    "DB05883",
                    "DB04419"
                ],
                "iPTMnet": [
                    "P01270"
                ],
                "MetOSite": [
                    "P01270"
                ],
                "PhosphoSitePlus": [
                    "P01270"
                ],
                "BioMuta": [
                    "PTH"
                ],
                "DMDM": [
                    "131547"
                ],
                "PaxDb": [
                    "9606-ENSP00000282091"
                ],
                "PeptideAtlas": [
                    "P01270"
                ],
                "ABCD": [
                    "P01270"
                ],
                "Antibodypedia": [
                    "11928"
                ],
                "DNASU": [
                    "5741"
                ],
                "Ensembl": [
                    "ENST00000282091.6",
                    "ENST00000529816.1"
                ],
                "KEGG": [
                    "hsa:5741"
                ],
                "MANE-Select": [
                    "ENST00000282091.6"
                ],
                "UCSC": [
                    "uc001mlb.4"
                ],
                "AGR": [
                    "HGNC:9606"
                ],
                "CTD": [
                    "5741"
                ],
                "DisGeNET": [
                    "5741"
                ],
                "GeneCards": [
                    "PTH"
                ],
                "HGNC": [
                    "HGNC:9606"
                ],
                "HPA": [
                    "ENSG00000152266"
                ],
                "MalaCards": [
                    "PTH"
                ],
                "neXtProt": [
                    "NX_P01270"
                ],
                "OpenTargets": [
                    "ENSG00000152266"
                ],
                "Orphanet": [
                    "189466"
                ],
                "PharmGKB": [
                    "PA33951"
                ],
                "VEuPathDB": [
                    "HostDB:ENSG00000152266"
                ],
                "eggNOG": [
                    "ENOG502SB2W"
                ],
                "GeneTree": [
                    "ENSGT00390000018603"
                ],
                "HOGENOM": [
                    "CLU_164143_0_0_1"
                ],
                "InParanoid": [
                    "P01270"
                ],
                "OMA": [
                    "HNLGEHR"
                ],
                "OrthoDB": [
                    "4209197at2759"
                ],
                "PhylomeDB": [
                    "P01270"
                ],
                "TreeFam": [
                    "TF336197"
                ],
                "PathwayCommons": [
                    "P01270"
                ],
                "Reactome": [
                    "R-HSA-373080",
                    "R-HSA-418555"
                ],
                "SignaLink": [
                    "P01270"
                ],
                "SIGNOR": [
                    "P01270"
                ],
                "BioGRID-ORCS": [
                    "5741"
                ],
                "EvolutionaryTrace": [
                    "P01270"
                ],
                "GeneWiki": [
                    "Parathyroid_hormone"
                ],
                "GenomeRNAi": [
                    "5741"
                ],
                "Pharos": [
                    "P01270"
                ],
                "PRO": [
                    "PR:P01270"
                ],
                "Proteomes": [
                    "UP000005640"
                ],
                "RNAct": [
                    "P01270"
                ],
                "Bgee": [
                    "ENSG00000152266"
                ],
                "GO": [
                    "GO:0005576",
                    "GO:0005615",
                    "GO:0005179",
                    "GO:0031856",
                    "GO:0051428",
                    "GO:0048018",
                    "GO:0031857",
                    "GO:0007189",
                    "GO:0030282",
                    "GO:0045453",
                    "GO:0046058",
                    "GO:0007267",
                    "GO:0007186",
                    "GO:0048873",
                    "GO:0008628",
                    "GO:0006874",
                    "GO:0009059",
                    "GO:0010960",
                    "GO:0071866",
                    "GO:1900158",
                    "GO:0032331",
                    "GO:0010629",
                    "GO:0055062",
                    "GO:0030501",
                    "GO:0071864",
                    "GO:0010628",
                    "GO:0046326",
                    "GO:0045725",
                    "GO:0060732",
                    "GO:0090290",
                    "GO:0009967",
                    "GO:0045944",
                    "GO:0010468",
                    "GO:0046686",
                    "GO:0045471",
                    "GO:0071774",
                    "GO:0010288",
                    "GO:0071107",
                    "GO:0033280",
                    "GO:0009410",
                    "GO:0007266",
                    "GO:0001501",
                    "GO:0006366"
                ],
                "InterPro": [
                    "IPR003625",
                    "IPR001415"
                ],
                "PANTHER": [
                    "PTHR10541",
                    "PTHR10541:SF2"
                ],
                "Pfam": [
                    "PF01279"
                ],
                "PIRSF": [
                    "PIRSF001832"
                ],
                "SMART": [
                    "SM00087"
                ],
                "PROSITE": [
                    "PS00335"
                ]
            },
            "citations": [
                {
                    "title": "Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone.",
                    "pubmedID": "6950381",
                    "doi": "10.1073\/pnas.78.12.7365"
                },
                {
                    "title": "Nucleotide sequence of the human parathyroid hormone gene.",
                    "pubmedID": "6220408",
                    "doi": "10.1073\/pnas.80.8.2127"
                },
                {
                    "title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
                    "pubmedID": "15489334",
                    "doi": "10.1101\/gr.2596504"
                },
                {
                    "title": "Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein.",
                    "pubmedID": "7829495",
                    "doi": "10.1074\/jbc.270.4.1629"
                },
                {
                    "title": "Structural analysis of human proparathyroid hormone by a new microsequencing approach.",
                    "pubmedID": "4833516",
                    "doi": "10.1038\/249155a0"
                },
                {
                    "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.",
                    "pubmedID": "15340161",
                    "doi": "10.1110\/ps.04682504"
                },
                {
                    "title": "The amino-acid sequence of the amino-terminal 37 residues of human parathyroid hormone.",
                    "pubmedID": "4521809",
                    "doi": "10.1073\/pnas.71.2.384"
                },
                {
                    "title": "Complete amino acid sequence of human parathyroid hormone.",
                    "pubmedID": "728431",
                    "doi": "10.1021\/bi00619a019"
                },
                {
                    "title": "A reinvestigation of the amino-terminal sequence of human parathyroid hormone.",
                    "pubmedID": "1125201",
                    "doi": "10.1021\/bi00680a006"
                },
                {
                    "title": "Solid-phase synthesis of the biologically active N-terminal 1-34 peptide of human parathyroid hormone.",
                    "pubmedID": "4474131",
                    "doi": "10.1515\/bchm2.1974.355.1.415"
                },
                {
                    "title": "Synthesis of sequence 1-34 of human parathyroid hormone.",
                    "pubmedID": "4721748",
                    "doi": "10.1002\/hlca.19730560139"
                },
                {
                    "title": "Stimulation of glucose transport in osteoblastic cells by parathyroid hormone and insulin-like growth factor I.",
                    "pubmedID": "21076856",
                    "doi": "10.1007\/s11010-010-0634-z"
                },
                {
                    "title": "Investigation of the solution structure of the human parathyroid hormone fragment (1-34) by 1H NMR spectroscopy, distance geometry, and molecular dynamics calculations.",
                    "pubmedID": "2069952",
                    "doi": "10.1021\/bi00242a018"
                },
                {
                    "title": "Stabilized NMR structure of human parathyroid hormone(1-34).",
                    "pubmedID": "8344299",
                    "doi": "10.1111\/j.1432-1033.1993.tb18037.x"
                },
                {
                    "title": "Structure of human parathyroid hormone 1-37 in solution.",
                    "pubmedID": "7797503",
                    "doi": "10.1074\/jbc.270.25.15194"
                },
                {
                    "title": "Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37).",
                    "pubmedID": "10623601",
                    "doi": "10.1006\/bbrc.1999.1958"
                },
                {
                    "title": "Crystal structure of human parathyroid hormone 1-34 at 0.9-A resolution.",
                    "pubmedID": "10837469",
                    "doi": "10.1074\/jbc.m001134200"
                },
                {
                    "title": "Molecular recognition of parathyroid hormone by its G protein-coupled receptor.",
                    "pubmedID": "18375760",
                    "doi": "10.1073\/pnas.0801027105"
                },
                {
                    "title": "Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism.",
                    "pubmedID": "2212001",
                    "doi": "10.1172\/jci114811"
                },
                {
                    "title": "A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism.",
                    "pubmedID": "10523031",
                    "doi": "10.1210\/jcem.84.10.6070"
                },
                {
                    "title": "Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone.",
                    "pubmedID": "18056632",
                    "doi": "10.1073\/pnas.0708725104"
                }
            ],
            "sequence": {
                "length": 115,
                "mass": 12861,
                "checksum": "849015736A6E5597",
                "modified": {
                    "$date": {
                        "$numberLong": "555811200000"
                    }
                },
                "version": 1,
                "sequence": "MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ"
            },
            "existence": 0,
            "relevance": 1,
            "proteinID": 3686908245
        }
    ],
    "singleCellExpressions": {
        "cellSignificanceIndex": []
    }
}