No CSI details found for gene ID: 2691
Other Information
This section provides additional information about the gene, including a description generated by an AI language model and details about associated proteins.
Genular Protein ID: 742483230
Symbol: SLIB_HUMAN
Name: Somatoliberin
UniProtKB Accession Codes:
Database IDs:
Citations:
PubMed ID: 6192430
Title: Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.
PubMed ID: 6192430
PubMed ID: 3918305
Title: Gene encoding human growth hormone-releasing factor precursor: structure, sequence, and chromosomal assignment.
PubMed ID: 3918305
DOI: 10.1073/pnas.82.1.63
PubMed ID: 11780052
Title: The DNA sequence and comparative analysis of human chromosome 20.
PubMed ID: 11780052
DOI: 10.1038/414865a
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 15489334
DOI: 10.1101/gr.2596504
PubMed ID: 6415488
Title: Expression-cloning and sequence of a cDNA encoding human growth hormone-releasing factor.
PubMed ID: 6415488
DOI: 10.1038/306086a0
PubMed ID: 6812220
Title: Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly.
PubMed ID: 6812220
PubMed ID: 24029240
Title: Comparative inhibition of the GH/IGF-I axis obtained with either the targeted secretion inhibitor SXN101959 or the somatostatin analog octreotide in growing male rats.
PubMed ID: 24029240
DOI: 10.1210/en.2013-1427
PubMed ID: 25944712
Title: N-terminome analysis of the human mitochondrial proteome.
PubMed ID: 25944712
PubMed ID: 2854259
Title: Solution conformations of human growth hormone releasing factor: comparison of the restrained molecular dynamics and distance geometry methods for a system without long-range distance data.
PubMed ID: 2854259
PubMed ID: 3029387
Title: Solution structure of human growth hormone releasing factor. Combined use of circular dichroism and nuclear magnetic resonance spectroscopy.
PubMed ID: 3029387
PubMed ID: 26324071
Title: Structural analysis of Clostridium botulinum neurotoxin type D as a platform for the development of targeted secretion inhibitors.
PubMed ID: 26324071
DOI: 10.1038/srep13397
Sequence Information:
- Length: 108
- Mass: 12447
- Checksum: 366AE05383488C53
- Sequence:
MPLWVFFFVI LTLSNSSHCS PPPPLTLRMR RYADAIFTNS YRKVLGQLSA RKLLQDIMSR QQGESNQERG ARARLGRQVD SMWAEQKQME LESILVALLQ KHSRNSQG
Details Unavailable
Detailed CSI data for this gene is not available. You will be redirected to a page with all available raw data in 3 seconds.
If you are not redirected automatically, please click here.
{
"geneID": 2691,
"tax": {
"id": 9606,
"name": [
{
"name": "Homo sapiens Linnaeus 1758"
},
{
"name": "Homo sapiens",
"type": 0
},
{
"name": "human",
"type": 4
}
]
},
"accession": {
"gene": [
"AL031659.9"
]
},
"genePos": {
"start": 37251086,
"end": 37261814
},
"orientation": false,
"symbol": "GHRH",
"created": {
"$date": {
"$numberLong": "1738333348830"
}
},
"crossReference": {
"enseGeneID": "ENSG00000118702",
"enseRnaID": [
"ENST00000237527.8"
],
"enseProtID": [
"ENSP00000237527.4"
]
},
"chrom": {
"pos": "20",
"type": 1,
"loc": "20q11.23"
},
"desc": "growth hormone releasing hormone",
"geneType": 5,
"mim": [
{
"id": 139190,
"relation": 0
}
],
"ontology": [
{
"id": "R-HSA-162582",
"term": "Signal Transduction",
"cat": 10
},
{
"id": "R-HSA-372790",
"term": "Signaling by GPCR",
"cat": 11
},
{
"id": "R-HSA-388396",
"term": "GPCR downstream signalling",
"cat": 12
},
{
"id": "R-HSA-500792",
"term": "GPCR ligand binding",
"cat": 12
},
{
"id": "R-HSA-373080",
"term": "Class B\/2 (Secretin family receptors)",
"cat": 13
},
{
"id": "R-HSA-418555",
"term": "G alpha (s) signalling events",
"cat": 13
},
{
"id": "R-HSA-420092",
"term": "Glucagon-type ligand receptors",
"cat": 14
},
{
"id": "GO:0005184",
"term": "neuropeptide hormone activity",
"cat": 0
},
{
"id": "GO:0016608",
"term": "growth hormone-releasing hormone activity",
"cat": 0
},
{
"id": "GO:0016608",
"term": "growth hormone-releasing hormone activity",
"pubMed": [
8421089,
18329818
],
"cat": 0
},
{
"id": "GO:0031770",
"term": "growth hormone-releasing hormone receptor binding",
"cat": 0
},
{
"id": "GO:0031770",
"term": "growth hormone-releasing hormone receptor binding",
"pubMed": [
1333056,
7680413
],
"cat": 0
},
{
"id": "GO:0051428",
"term": "peptide hormone receptor binding",
"cat": 0
},
{
"id": "GO:0007189",
"term": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
"cat": 1
},
{
"id": "GO:0007189",
"term": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
"pubMed": [
3008329
],
"cat": 1
},
{
"id": "GO:0007189",
"term": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
"pubMed": [
1333056,
7680413
],
"cat": 1
},
{
"id": "GO:0007267",
"term": "cell-cell signaling",
"pubMed": [
6192430
],
"cat": 1
},
{
"id": "GO:0008284",
"term": "positive regulation of cell population proliferation",
"pubMed": [
12867592
],
"cat": 1
},
{
"id": "GO:0021984",
"term": "adenohypophysis development",
"cat": 1
},
{
"id": "GO:0030252",
"term": "growth hormone secretion",
"cat": 1
},
{
"id": "GO:0030252",
"term": "growth hormone secretion",
"pubMed": [
2857452
],
"cat": 1
},
{
"id": "GO:0032094",
"term": "response to food",
"cat": 1
},
{
"id": "GO:0032880",
"term": "regulation of protein localization",
"cat": 1
},
{
"id": "GO:0035264",
"term": "multicellular organism growth",
"pubMed": [
8421089
],
"cat": 1
},
{
"id": "GO:0040018",
"term": "positive regulation of multicellular organism growth",
"pubMed": [
8421089
],
"cat": 1
},
{
"id": "GO:0043568",
"term": "positive regulation of insulin-like growth factor receptor signaling pathway",
"pubMed": [
11773624
],
"cat": 1
},
{
"id": "GO:0046005",
"term": "positive regulation of circadian sleep\/wake cycle, REM sleep",
"pubMed": [
15538933
],
"cat": 1
},
{
"id": "GO:0046005",
"term": "positive regulation of circadian sleep\/wake cycle, REM sleep",
"pubMed": [
18329818
],
"cat": 1
},
{
"id": "GO:0060124",
"term": "positive regulation of growth hormone secretion",
"pubMed": [
3008329
],
"cat": 1
},
{
"id": "GO:0060124",
"term": "positive regulation of growth hormone secretion",
"pubMed": [
8421089,
18329818
],
"cat": 1
},
{
"id": "GO:0060124",
"term": "positive regulation of growth hormone secretion",
"pubMed": [
15538933
],
"cat": 1
},
{
"id": "GO:0060124",
"term": "positive regulation of growth hormone secretion",
"pubMed": [
11773624
],
"cat": 1
},
{
"id": "GO:0005576",
"term": "extracellular region",
"pubMed": [
11773624
],
"cat": 2
},
{
"id": "GO:0005576",
"term": "extracellular region",
"cat": 2
},
{
"id": "GO:0005615",
"term": "extracellular space",
"cat": 2
},
{
"id": "GO:0043195",
"term": "terminal bouton",
"cat": 2
},
{
"id": "GO:0043204",
"term": "perikaryon",
"cat": 2
}
],
"protein": [
{
"symbol": "SLIB_HUMAN",
"name": "Somatoliberin",
"accession": [
"P01286",
"Q4KN10",
"Q5JYR1"
],
"databaseIDs": {
"NCBI Taxonomy": [
"9606"
],
"EMBL": [
"L29177",
"L00137",
"L00134",
"L00135",
"L00136",
"L00137",
"L00134",
"L00135",
"L00136",
"AL031659",
"BC098109",
"BC098161",
"BC099727",
"X00094",
"X00094"
],
"CCDS": [
"CCDS13292.1",
"CCDS54460.1"
],
"PIR": [
"A21902"
],
"RefSeq": [
"NP_001171660.1",
"NP_066567.1",
"XP_011527086.1",
"XP_011527090.1"
],
"PDB": [
"5BQM",
"7CZ5",
"7V9M"
],
"PDBsum": [
"5BQM",
"7CZ5",
"7V9M"
],
"AlphaFoldDB": [
"P01286"
],
"BMRB": [
"P01286"
],
"EMDB": [
"EMD-30505",
"EMD-31825"
],
"SMR": [
"P01286"
],
"BioGRID": [
"108958"
],
"IntAct": [
"P01286"
],
"MINT": [
"P01286"
],
"STRING": [
"9606.ENSP00000362716"
],
"BioMuta": [
"GHRH"
],
"DMDM": [
"134521"
],
"MassIVE": [
"P01286"
],
"PaxDb": [
"9606-ENSP00000362716"
],
"PeptideAtlas": [
"P01286"
],
"Antibodypedia": [
"11938"
],
"DNASU": [
"2691"
],
"Ensembl": [
"ENST00000237527.8",
"ENST00000373614.7",
"ENST00000709405.1",
"ENST00000709406.1"
],
"KEGG": [
"hsa:2691"
],
"MANE-Select": [
"ENST00000373614.7"
],
"UCSC": [
"uc002xgr.5"
],
"AGR": [
"HGNC:4265"
],
"CTD": [
"2691"
],
"DisGeNET": [
"2691"
],
"GeneCards": [
"GHRH"
],
"HGNC": [
"HGNC:4265"
],
"HPA": [
"ENSG00000118702"
],
"MIM": [
"139190"
],
"neXtProt": [
"NX_P01286"
],
"OpenTargets": [
"ENSG00000118702"
],
"PharmGKB": [
"PA28675"
],
"VEuPathDB": [
"HostDB:ENSG00000118702"
],
"eggNOG": [
"ENOG502S2N6"
],
"GeneTree": [
"ENSGT00950000183154"
],
"HOGENOM": [
"CLU_174932_0_0_1"
],
"InParanoid": [
"P01286"
],
"OMA": [
"DSVWTDQ"
],
"OrthoDB": [
"4097249at2759"
],
"PhylomeDB": [
"P01286"
],
"TreeFam": [
"TF353187"
],
"PathwayCommons": [
"P01286"
],
"Reactome": [
"R-HSA-418555",
"R-HSA-420092"
],
"SignaLink": [
"P01286"
],
"BioGRID-ORCS": [
"2691"
],
"GenomeRNAi": [
"2691"
],
"Pharos": [
"P01286"
],
"PRO": [
"PR:P01286"
],
"Proteomes": [
"UP000005640"
],
"RNAct": [
"P01286"
],
"Bgee": [
"ENSG00000118702"
],
"GO": [
"GO:0005576",
"GO:0005615",
"GO:0043204",
"GO:0043195",
"GO:0016608",
"GO:0031770",
"GO:0005184",
"GO:0051428",
"GO:0021984",
"GO:0007189",
"GO:0007267",
"GO:0030252",
"GO:0035264",
"GO:0008284",
"GO:0046005",
"GO:0060124",
"GO:0043568",
"GO:0040018",
"GO:0032880",
"GO:0032094"
],
"InterPro": [
"IPR000532",
"IPR046963"
],
"PANTHER": [
"PTHR11213",
"PTHR11213:SF6"
],
"Pfam": [
"PF00123"
],
"SMART": [
"SM00070"
],
"PROSITE": [
"PS00260"
]
},
"citations": [
{
"title": "Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.",
"pubmedID": "6192430",
"doi": "10.1073\/pnas.80.14.4311"
},
{
"title": "Gene encoding human growth hormone-releasing factor precursor: structure, sequence, and chromosomal assignment.",
"pubmedID": "3918305",
"doi": "10.1073\/pnas.82.1.63"
},
{
"title": "The DNA sequence and comparative analysis of human chromosome 20.",
"pubmedID": "11780052",
"doi": "10.1038\/414865a"
},
{
"title": "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).",
"pubmedID": "15489334",
"doi": "10.1101\/gr.2596504"
},
{
"title": "Expression-cloning and sequence of a cDNA encoding human growth hormone-releasing factor.",
"pubmedID": "6415488",
"doi": "10.1038\/306086a0"
},
{
"title": "Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly.",
"pubmedID": "6812220",
"doi": "10.1126\/science.6812220"
},
{
"title": "Comparative inhibition of the GH\/IGF-I axis obtained with either the targeted secretion inhibitor SXN101959 or the somatostatin analog octreotide in growing male rats.",
"pubmedID": "24029240",
"doi": "10.1210\/en.2013-1427"
},
{
"title": "N-terminome analysis of the human mitochondrial proteome.",
"pubmedID": "25944712",
"doi": "10.1002\/pmic.201400617"
},
{
"title": "Solution conformations of human growth hormone releasing factor: comparison of the restrained molecular dynamics and distance geometry methods for a system without long-range distance data.",
"pubmedID": "2854259",
"doi": "10.1093\/protein\/1.5.399"
},
{
"title": "Solution structure of human growth hormone releasing factor. Combined use of circular dichroism and nuclear magnetic resonance spectroscopy.",
"pubmedID": "3029387",
"doi": "10.1016\/0022-2836(86)90147-6"
},
{
"title": "Structural analysis of Clostridium botulinum neurotoxin type D as a platform for the development of targeted secretion inhibitors.",
"pubmedID": "26324071",
"doi": "10.1038\/srep13397"
}
],
"sequence": {
"length": 108,
"mass": 12447,
"checksum": "366AE05383488C53",
"modified": {
"$date": {
"$numberLong": "522288000000"
}
},
"version": 1,
"sequence": "MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG"
},
"existence": 0,
"relevance": 1,
"proteinID": 742483230
}
],
"singleCellExpressions": {
"cellSignificanceIndex": []
}
}